![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_70567.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 122aa MW: 13377.1 Da PI: 6.3808 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 80.5 | 2.6e-25 | 41 | 103 | 2 | 64 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkk 64
Fl+k+y++++d+ +++++sw e+ +fvv+ + efa+++Lp+yFkh+nf+SFvRQLn+Y ++
MLOC_70567.2 41 FLTKTYQLVDDPCTDHIVSWGEDDATFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYVCHS 103
9**********************************************************7665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 3.9E-27 | 35 | 103 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 3.6E-25 | 37 | 121 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 2.58E-23 | 38 | 112 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 6.4E-16 | 41 | 64 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 1.7E-21 | 41 | 103 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 6.4E-16 | 79 | 91 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 6.4E-16 | 92 | 104 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0042802 | Molecular Function | identical protein binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 122 aa Download sequence Send to blast |
MAFLVERCGE MVVSMEMGSG AHGGGGGGGG GGVGKPVPAP FLTKTYQLVD DPCTDHIVSW 60 GEDDATFVVW RPPEFARDLL PNYFKHNNFS SFVRQLNTYV CHSSYSLSPA PYTTHERMHP 120 HM |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 1e-16 | 17 | 99 | 3 | 87 | Heat shock factor protein 1 |
| 5d5v_B | 1e-16 | 17 | 99 | 3 | 87 | Heat shock factor protein 1 |
| 5d5v_D | 1e-16 | 17 | 99 | 3 | 87 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269|PubMed:16202242}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_70567.2 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK376881 | 1e-166 | AK376881.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3143C10. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006658884.1 | 8e-55 | PREDICTED: heat stress transcription factor B-4b-like | ||||
| Swissprot | Q7XHZ0 | 2e-52 | HFB4B_ORYSJ; Heat stress transcription factor B-4b | ||||
| TrEMBL | F2EL53 | 5e-67 | F2EL53_HORVV; Predicted protein | ||||
| STRING | MLOC_70567.1 | 4e-68 | (Hordeum vulgare) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G46264.1 | 1e-40 | heat shock transcription factor B4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




