![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_72428.3 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 117aa MW: 12889.8 Da PI: 6.5378 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 180.9 | 1.1e-56 | 17 | 110 | 1 | 94 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
vreqdrflPian+srimkk++Pan+ki+kdaket+qecvsefisfvtseasdkcq+ekrktingddllwa+atlGfe+yv+plk+yl+kyr++
MLOC_72428.3 17 VREQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEEYVDPLKIYLQKYRDVI 110
69*****************************************************************************************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.1E-52 | 16 | 108 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 7.45E-39 | 20 | 109 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 5.4E-29 | 23 | 87 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.7E-22 | 51 | 69 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 54 | 70 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.7E-22 | 70 | 88 | No hit | No description |
| PRINTS | PR00615 | 1.7E-22 | 89 | 107 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 117 aa Download sequence Send to blast |
MADDDSGSPR GGGGGGVREQ DRFLPIANIS RIMKKAVPAN GKIAKDAKET LQECVSEFIS 60 FVTSEASDKC QKEKRKTING DDLLWAMATL GFEEYVDPLK IYLQKYRDVI VALARCC |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_B | 5e-48 | 16 | 108 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 5e-48 | 16 | 108 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_72428.3 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK376672 | 0.0 | AK376672.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3131D13. | |||
| GenBank | JF764601 | 0.0 | JF764601.1 Hordeum vulgare NF-YB2 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020182576.1 | 2e-72 | nuclear transcription factor Y subunit B-2-like | ||||
| Refseq | XP_020182577.1 | 2e-72 | nuclear transcription factor Y subunit B-2-like | ||||
| Swissprot | Q5QMG3 | 4e-64 | NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2 | ||||
| TrEMBL | A0A287M434 | 1e-81 | A0A287M434_HORVV; Uncharacterized protein | ||||
| STRING | EMT21068 | 1e-74 | (Aegilops tauschii) | ||||
| STRING | MLOC_72428.4 | 3e-75 | (Hordeum vulgare) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 1e-62 | nuclear factor Y, subunit B3 | ||||




