![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_72873.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 97aa MW: 10507.8 Da PI: 9.0088 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 106.4 | 1.5e-33 | 46 | 97 | 2 | 53 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGg 53
++++l+cprC s++tkfCyynnys++qPr++C++CrryWt+GG+lr vPvGg
MLOC_72873.2 46 QQEKLECPRCSSSDTKFCYYNNYSTAQPRHYCRTCRRYWTHGGTLRKVPVGG 97
67899**********************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 3.0E-21 | 46 | 97 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 2.8E-30 | 48 | 97 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 26.44 | 50 | 97 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 52 | 88 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 97 aa Download sequence Send to blast |
MAPASASLLP AAGAKRPFAA DSAVDAADEG QPLAQSAVTK KHGESQQEKL ECPRCSSSDT 60 KFCYYNNYST AQPRHYCRTC RRYWTHGGTL RKVPVGG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_72873.2 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin and salicylic acid (SA). {ECO:0000269|PubMed:10758484}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK371500 | 1e-153 | AK371500.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2135N06. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020186822.1 | 1e-50 | dof zinc finger protein DOF1.7-like | ||||
| Swissprot | Q39088 | 2e-27 | DOF34_ARATH; Dof zinc finger protein DOF3.4 | ||||
| Swissprot | Q9FGD6 | 1e-27 | DOF58_ARATH; Dof zinc finger protein DOF5.8 | ||||
| TrEMBL | A0A287JMS6 | 3e-65 | A0A287JMS6_HORVV; Uncharacterized protein | ||||
| STRING | MLOC_72873.1 | 5e-57 | (Hordeum vulgare) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G66940.1 | 2e-29 | Dof family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




