![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_73122.3 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 140aa MW: 16169.7 Da PI: 9.5232 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 48.1 | 2.7e-15 | 38 | 82 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+WT+eE+ ++ + ++lG+g+W+ Ia+ + ++Rt+ q+ s+ qky
MLOC_73122.3 38 PWTEEEHRTFLAGLEKLGKGDWRGIAKNFVTTRTPTQVASHAQKY 82
8*******************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 6.1E-11 | 35 | 85 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.73E-17 | 36 | 87 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 15.436 | 37 | 87 | IPR017930 | Myb domain |
| TIGRFAMs | TIGR01557 | 2.2E-18 | 37 | 86 | IPR006447 | Myb domain, plants |
| CDD | cd00167 | 2.19E-11 | 38 | 83 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 9.5E-13 | 38 | 81 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 4.3E-13 | 38 | 82 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 140 aa Download sequence Send to blast |
MQREIYMRIF FFHLQLFDAY IICCHSVNSI YCNYAAVPWT EEEHRTFLAG LEKLGKGDWR 60 GIAKNFVTTR TPTQVASHAQ KYFLRQTNPN KKKRRSSLFD MMASDLSPAP NCPILPPTMA 120 KFHDMVTMTN QLQNSSLVSS |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 90 | 94 | KKKRR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses weakly the sugar-repressed transcription of promoters containing SRS. Contributes to the sugar-repressed transcription of promoters containing 5'-TATCCA-3' elements. {ECO:0000269|PubMed:12172034}. | |||||
| UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress weakly the sugar-repressed transcription of promoters containing SRS. Contributes to the sugar-repressed transcription of promoters containing 5'-TATCCA-3' elements. {ECO:0000250|UniProtKB:Q7XC51}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_73122.3 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by sucrose. Slightly repressed by gibberellic acid (GA). {ECO:0000269|PubMed:12172034}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK366649 | 1e-172 | AK366649.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2045F05. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020193360.1 | 3e-70 | uncharacterized protein LOC109779160 isoform X1 | ||||
| Refseq | XP_020193361.1 | 3e-71 | transcription factor SRM1-like isoform X2 | ||||
| Swissprot | B8BI93 | 1e-36 | MYBS2_ORYSI; Transcription factor MYBS2 | ||||
| Swissprot | Q7XC51 | 1e-36 | MYBS2_ORYSJ; Transcription factor MYBS2 | ||||
| TrEMBL | M0YUH7 | 1e-100 | M0YUH7_HORVV; Uncharacterized protein | ||||
| STRING | MLOC_73122.2 | 1e-101 | (Hordeum vulgare) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47390.1 | 3e-36 | MYB_related family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




