PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_78895.2
Organism
Hordeum vulgare
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB_related
Protein Properties Length: 62aa    MW: 7115.92 Da    PI: 6.4992
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_78895.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.21.8e-13439137
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37
                     rg W + Ede+l+++v+++G+++W++Ia++++ gR++
     MLOC_78895.2  4 RGHWRPSEDERLKELVARYGPHNWNAIAEKLQ-GRSG 39
                     899*****************************.**97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.529156IPR017930Myb domain
SuperFamilySSF466896.8E-10339IPR009057Homeodomain-like
SMARTSM007176.2E-4352IPR001005SANT/Myb domain
PfamPF002492.4E-12439IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-12439IPR009057Homeodomain-like
CDDcd001672.67E-9739No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MCTRGHWRPS EDERLKELVA RYGPHNWNAI AEKLQGRSGT IDETCMHMHD HASTDHACVE  60
SI
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_78895.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1474263e-39AC147426.2 Oryza sativa chromosome 3 B1377B10 genomic sequence, complete sequence.
GenBankAF3779463e-39AF377946.3 Oryza sativa (japonica cultivar-group) chromosome 3, BAC clone OSJNBa0031O09, complete sequence.
GenBankAP0149593e-39AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126113e-39CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020166078.13e-21transcription factor MYB52-like
SwissprotQ6R0C42e-17MYB52_ARATH; Transcription factor MYB52
TrEMBLA0A287N4A02e-39A0A287N4A0_HORVV; Uncharacterized protein
STRINGEMT051862e-21(Aegilops tauschii)
STRINGTraes_4BS_AAFB56987.18e-21(Triticum aestivum)
STRINGTraes_4DS_926486EE0.17e-21(Triticum aestivum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.17e-20myb domain protein 52
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Cassan-Wang H, et al.
    Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis.
    Front Plant Sci, 2013. 4: p. 189
    [PMID:23781226]
  3. Shi D, et al.
    MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage.
    Plant Physiol., 2018. 176(4): p. 2737-2749
    [PMID:29440562]