![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Manes.01G238100.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 68aa MW: 7766.57 Da PI: 4.6294 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 47.2 | 7.3e-15 | 22 | 68 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
lp+G rFhP+deelv++yLk+k +g++++ + i ev+i++++P+dLp
Manes.01G238100.1.p 22 LPVGWRFHPSDEELVDHYLKRKRRGDPIDGLD-IGEVQICDYDPKDLP 68
799************************99955.**************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 9.42E-16 | 13 | 68 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 17.454 | 22 | 68 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.4E-7 | 23 | 46 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 68 aa Download sequence Send to blast |
MNNNSYSSYS SSGSPQFVPL NLPVGWRFHP SDEELVDHYL KRKRRGDPID GLDIGEVQIC 60 DYDPKDLP |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Manes.01G238100.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021635388.1 | 1e-24 | NAC domain-containing protein 69-like | ||||
| TrEMBL | A0A2C9WR64 | 8e-43 | A0A2C9WR64_MANES; Uncharacterized protein (Fragment) | ||||
| STRING | cassava4.1_028980m | 1e-43 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF11433 | 17 | 39 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G04400.1 | 6e-13 | NAC domain containing protein 77 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Manes.01G238100.1.p |




