![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Manes.08G096400.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
| Family | BES1 | ||||||||
| Protein Properties | Length: 104aa MW: 12027.8 Da PI: 10.8307 | ||||||||
| Description | BES1 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF822 | 126.1 | 4.3e-39 | 33 | 100 | 3 | 70 |
DUF822 3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyr 70
+ r p+ Er nnk+RERrRRa++ ki+aGLR++Gnyklpk+aD n+ lkALc+eAGw ve+DGt yr
Manes.08G096400.1.p 33 KYRFPSDSERQNNKQRERRRRAVTRKIFAGLRKHGNYKLPKHADTNDLLKALCEEAGWHVEEDGTIYR 100
6689999************************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF05687 | 3.0E-35 | 34 | 100 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 104 aa Download sequence Send to blast |
MADEKTRAMK GCIKSGRGPW IVHRSTKDGV VTKYRFPSDS ERQNNKQRER RRRAVTRKIF 60 AGLRKHGNYK LPKHADTNDL LKALCEEAGW HVEEDGTIYR FKV* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5zd4_A | 1e-15 | 54 | 100 | 391 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_B | 1e-15 | 54 | 100 | 391 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_C | 1e-15 | 54 | 100 | 391 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_D | 1e-15 | 54 | 100 | 391 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Manes.08G096400.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017976358.1 | 1e-54 | PREDICTED: protein BZR1 homolog 3 | ||||
| TrEMBL | A0A2C9VEV9 | 2e-71 | A0A2C9VEV9_MANES; Uncharacterized protein | ||||
| STRING | cassava4.1_031582m | 2e-71 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF15152 | 11 | 13 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G36780.1 | 7e-20 | BES1/BZR1 homolog 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Manes.08G096400.1.p |




