![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Manes.11G137700.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
| Family | WOX | ||||||||
| Protein Properties | Length: 105aa MW: 12399.3 Da PI: 10.7428 | ||||||||
| Description | WOX family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 65.5 | 7.1e-21 | 7 | 66 | 3 | 57 |
--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
Homeobox 3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
+R+++t+eql +Leel+++ r+p+a+++++++++l +++ ++V++WFqN++a++++
Manes.11G137700.1.p 7 SRWCPTPEQLMILEELYRSgIRTPNASQIQRITSHLslygKIEGKNVFYWFQNHKARDRQ 66
7*****************99*************************************996 PP
| |||||||
| 2 | Wus_type_Homeobox | 123 | 1.1e-39 | 5 | 67 | 2 | 64 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
a++RW+PtpeQ++iLeely+sG+rtPn+++iqrit++L+ yGkie+kNVfyWFQN+kaR+rqk
Manes.11G137700.1.p 5 ASSRWCPTPEQLMILEELYRSGIRTPNASQIQRITSHLSLYGKIEGKNVFYWFQNHKARDRQK 67
689***********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50071 | 10.139 | 2 | 67 | IPR001356 | Homeobox domain |
| SMART | SM00389 | 1.5E-5 | 4 | 71 | IPR001356 | Homeobox domain |
| Pfam | PF00046 | 1.2E-18 | 7 | 66 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 7.27E-12 | 7 | 67 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 3.1E-8 | 7 | 66 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 4.34E-4 | 8 | 67 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0008283 | Biological Process | cell proliferation | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0009943 | Biological Process | adaxial/abaxial axis specification | ||||
| GO:0009947 | Biological Process | centrolateral axis specification | ||||
| GO:0010865 | Biological Process | stipule development | ||||
| GO:0048513 | Biological Process | animal organ development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 105 aa Download sequence Send to blast |
MSPAASSRWC PTPEQLMILE ELYRSGIRTP NASQIQRITS HLSLYGKIEG KNVFYWFQNH 60 KARDRQKLRR KLLKQLQHNQ IYLQNQSPPF HPLPYHHSPA LLPQV |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269|PubMed:11751640, ECO:0000269|PubMed:15169755}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Manes.11G137700.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021666132.1 | 6e-54 | WUSCHEL-related homeobox 3-like | ||||
| Swissprot | Q9SIB4 | 1e-42 | WOX3_ARATH; WUSCHEL-related homeobox 3 | ||||
| TrEMBL | A0A2C9V2A3 | 1e-71 | A0A2C9V2A3_MANES; Uncharacterized protein (Fragment) | ||||
| STRING | cassava4.1_030827m | 2e-71 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF10632 | 29 | 40 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G28610.1 | 5e-39 | WOX family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Manes.11G137700.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




