![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Manes.12G122200.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 101aa MW: 11243.2 Da PI: 10.8371 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 83.7 | 1.1e-26 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
ri+n++ rqvtfskRr+g++KKA+EL +LCdaev + ifss+gklye++s
Manes.12G122200.1.p 10 RIDNSTSRQVTFSKRRKGLIKKAKELAILCDAEVGLAIFSSSGKLYEFAS 59
8***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 4.8E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 30.796 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 5.76E-28 | 2 | 72 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 4.71E-36 | 2 | 60 | No hit | No description |
| PRINTS | PR00404 | 4.4E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.2E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.4E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.4E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
MGRGKIVIRR IDNSTSRQVT FSKRRKGLIK KAKELAILCD AEVGLAIFSS SGKLYEFAST 60 RLDMFFSTTT SIVSLLLLQN YNHQFLLSAL IVSWEKLASL * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6bz1_A | 5e-20 | 1 | 63 | 1 | 63 | MEF2 CHIMERA |
| 6bz1_B | 5e-20 | 1 | 63 | 1 | 63 | MEF2 CHIMERA |
| 6bz1_C | 5e-20 | 1 | 63 | 1 | 63 | MEF2 CHIMERA |
| 6bz1_D | 5e-20 | 1 | 63 | 1 | 63 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269|PubMed:23463009}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Manes.12G122200.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015890524.1 | 2e-35 | MADS-box transcription factor 23 | ||||
| Refseq | XP_022741403.1 | 1e-35 | agamous-like MADS-box protein AGL21 | ||||
| Swissprot | Q6Z6W2 | 3e-32 | MAD57_ORYSJ; MADS-box transcription factor 57 | ||||
| TrEMBL | A0A2C9UVZ9 | 5e-65 | A0A2C9UVZ9_MANES; Uncharacterized protein | ||||
| STRING | cassava4.1_022451m | 2e-35 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G37940.1 | 2e-34 | AGAMOUS-like 21 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Manes.12G122200.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




