![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Manes.15G070500.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 160aa MW: 16866.9 Da PI: 8.5211 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 62.8 | 7.1e-20 | 65 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd +l+++v+++G g+W+++ r+ g+ R++k+c++rw ++l
Manes.15G070500.1.p 65 KGPWTAEEDAILAEYVRKHGEGNWNAVQRHSGLSRCGKSCRLRWANHL 112
79******************************************9996 PP
| |||||||
| 2 | Myb_DNA-binding | 25.2 | 3.9e-08 | 118 | 146 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30
+g++++eE+ l+v++++++G++ W++ a
Manes.15G070500.1.p 118 KGAFSPEEERLIVELHAKFGNK-WARMATL 146
799*******************.***9976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 23.282 | 60 | 116 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.0E-25 | 61 | 115 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.0E-16 | 64 | 114 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 7.6E-18 | 65 | 112 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 5.64E-26 | 66 | 142 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 5.02E-14 | 67 | 112 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 3.2E-13 | 116 | 147 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 8.329 | 117 | 159 | IPR017930 | Myb domain |
| SMART | SM00717 | 0.76 | 117 | 159 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.0E-7 | 118 | 147 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 7.96E-4 | 120 | 147 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 160 aa Download sequence Send to blast |
MISTINGGSE GAGFSGSIGG GVDVAAAAAI HQGGGDMHAN VHHGVNGTGS CSGGNDGNGE 60 THLKKGPWTA EEDAILAEYV RKHGEGNWNA VQRHSGLSRC GKSCRLRWAN HLRPNLKKGA 120 FSPEEERLIV ELHAKFGNKW ARMATLVSIY GFNFTLFLL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 6e-22 | 63 | 148 | 5 | 89 | B-MYB |
| 1h8a_C | 9e-22 | 63 | 148 | 25 | 109 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator (PubMed:24278028, PubMed:25268707). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter (e.g. alpha-amylase) to promote their expression (PubMed:11743113). Positive regulator of abscisic acid (ABA) responses leading to growth arrest during seed germination (PubMed:17217461). Promotes the expression of aleurone-related genes (e.g. CP1, CP, GASA1, BXL1 and BXL2) in seeds. Together with MYB33 and MYB65, promotes the programmed cell death (PCD) leading to vacuolation of protein storage vacuoles (PSVs) in the aleurone layers during seed germination (PubMed:20699403). Maybe involved in the regulation of leaves lamina morphogenesis (PubMed:25268707). Involved in pollen grain development (PubMed:22101548). Together with MYB97 and MYB120, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:17217461, ECO:0000269|PubMed:20699403, ECO:0000269|PubMed:22101548, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028, ECO:0000269|PubMed:25268707}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Manes.15G070500.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed in germinating seeds by microRNA159 (miR159)-mediated cleavage in an abscisic acid (ABA) and ABI3-dependent manner, probably to desensitize hormone signaling during seedling stress responses (PubMed:15226253, PubMed:17217461). Induced by increased upon gibberellic acid (GA) treatment (PubMed:20699403). {ECO:0000269|PubMed:15226253, ECO:0000269|PubMed:17217461, ECO:0000269|PubMed:20699403}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021594422.1 | 1e-103 | transcription factor MYB120-like | ||||
| Swissprot | O80883 | 2e-48 | MB101_ARATH; Transcription factor MYB101 | ||||
| TrEMBL | A0A2C9UFM9 | 1e-112 | A0A2C9UFM9_MANES; Uncharacterized protein | ||||
| STRING | cassava4.1_027117m | 1e-102 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G32460.1 | 8e-50 | myb domain protein 101 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Manes.15G070500.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




