PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Mapoly0160s0029.1.p

Organism

Marchantia polymorpha

Taxonomic ID

3197

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia

Family

ARF

Protein Properties

Length: 158aa MW: 18019.7 Da PI: 6.787

Description

ARF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Mapoly0160s0029.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	B3	31.1	4.1e-10	79	128	41	94
TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS B3 41 esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 ++ + W +++iyr++++ ++lt+ + Fv+a++L++gDf+ + ++f++v+ Mapoly0160s0029.1.p 79 PEKELWYFRHIYRGQPRIHLLTTRCSVFVNAKRLQAGDFISVE----MRFKMVF 128 55588***********************************999....5566555 PP
2	Auxin_resp	37	1.4e-13	117	157	38	78
Auxin_resp 38 kvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSk 78 +sv mRfkm fet++s +r++ t++g+ d+ p+rWp S+ Mapoly0160s0029.1.p 117 FISVEMRFKMVFETKESDVQRYMETITGIGDVGPLRWPSSH 157 57999*********************************996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101936	4.05E-8	78	123	IPR015300	DNA-binding pseudobarrel domain
Pfam	PF02362	2.2E-7	79	127	IPR003340	B3 DNA binding domain
Gene3D	G3DSA:2.40.330.10	5.1E-9	81	121	IPR015300	DNA-binding pseudobarrel domain
Pfam	PF06507	1.5E-9	118	157	IPR010525	Auxin response factor

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009725	Biological Process	response to hormone
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 158 aa Download sequence Send to blast
MCEPLVSVPT VGSRMIYFPQ GHSEQVAASI QKEADVHISN YPSLPLRLNC LLDNVTLHAD 60 METDEVYTRM TLLPMSGSPE KELWYFRHIY RGQPRIHLLT TRCSVFVNAK RLQAGDFISV 120 EMRFKMVFET KESDVQRYME TITGIGDVGP LRWPSSH*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4ldu_A	8e-20	4	75	62	133	Auxin response factor 5
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Seems to act as transcriptional activator. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Regulates both stamen and gynoecium maturation. Promotes jasmonic acid production. Partially redundant with ARF6. Involved in fruit initiation. Acts as an inhibitor to stop further carpel development in the absence of fertilization and the generation of signals required to initiate fruit and seed development. {ECO:0000269\|PubMed:12036261, ECO:0000269\|PubMed:16107481, ECO:0000269\|PubMed:16829592}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by miR167. {ECO:0000269\|PubMed:17021043}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KP877969	1e-105	KP877969.1 Marchantia polymorpha auxin response factor 1 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022759402.1	3e-49	auxin response factor 8-like isoform X3
Swissprot	Q9FGV1	1e-28	ARFH_ARATH; Auxin response factor 8
TrEMBL	A0A2R6W411	1e-115	A0A2R6W411_MARPO; Auxin response factor
STRING	TRIUR3_32597-P1	5e-40	(Triticum urartu)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP856	14	56

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G37020.1	6e-31	auxin response factor 8

Link Out ? help Back to Top
Phytozome	Mapoly0160s0029.1.p

Publications ? help Back to Top
Liu N, et al. Down-regulation of AUXIN RESPONSE FACTORS 6 and 8 by microRNA 167 leads to floral development defects and female sterility in tomato. J. Exp. Bot., 2014. 65(9): p. 2507-20 [PMID:24723401] Minato N, et al. The phytoplasmal virulence factor TENGU causes plant sterility by downregulating of the jasmonic acid and auxin pathways. Sci Rep, 2014. 4: p. 7399 [PMID:25492247] Ortega-Amaro MA, et al. Overexpression of AtGRDP2, a novel glycine-rich domain protein, accelerates plant growth and improves stress tolerance. Front Plant Sci, 2014. 5: p. 782 [PMID:25653657] Wang Y, et al. MicroRNA167-Directed Regulation of the Auxin Response Factors GmARF8a and GmARF8b Is Required for Soybean Nodulation and Lateral Root Development. Plant Physiol., 2015. 168(3): p. 984-99 [PMID:25941314] Barik S, et al. Coevolution Pattern and Functional Conservation or Divergence of miR167s and their targets across Diverse Plant Species. Sci Rep, 2015. 5: p. 14611 [PMID:26459056] Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants. Plant Physiol. Biochem., 2016. 104: p. 146-54 [PMID:27031426] Mlotshwa S,Pruss GJ,MacArthur JL,Reed JW,Vance V Developmental Defects Mediated by the P1/HC-Pro Potyviral Silencing Suppressor Are Not Due to Misregulation of AUXIN RESPONSE FACTOR 8. Plant Physiol., 2016. 172(3): p. 1853-1861 [PMID:27688620] Wójcikowska B,Gaj MD Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis. Plant Cell Rep., 2017. 36(6): p. 843-858 [PMID:28255787] Zhang GZ, et al. Ectopic expression of UGT84A2 delayed flowering by indole-3-butyric acid-mediated transcriptional repression of ARF6 and ARF8 genes in Arabidopsis. Plant Cell Rep., 2017. 36(12): p. 1995-2006 [PMID:29027578] Zheng K, et al. Involvement of PACLOBUTRAZOL RESISTANCE6/KIDARI, an Atypical bHLH Transcription Factor, in Auxin Responses in Arabidopsis. Front Plant Sci, 2017. 8: p. 1813 [PMID:29114256] Liu Z, et al. ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis. Plant Cell Physiol., 2018. 59(1): p. 179-189 [PMID:29145642] Ghelli R, et al. A Newly Identified Flower-Specific Splice Variant of AUXIN RESPONSE FACTOR8 Regulates Stamen Elongation and Endothecium Lignification in Arabidopsis. Plant Cell, 2018. 30(3): p. 620-637 [PMID:29514943]