PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Medtr0023s0210.1

Common Name

MTR_0023s0210

Organism

Medicago truncatula

Taxonomic ID

3880

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago

Family

MYB_related

Protein Properties

Length: 84aa MW: 9910.46 Da PI: 10.5868

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Medtr0023s0210.1	genome	Mt	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	58.8	1.2e-18	9	56	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd ll+ +++++G g W++++r+ g++R++k+c++rw++yl Medtr0023s0210.1 9 KGTWTNEEDNLLKACINKYGQGKWHLVPRRAGLNRCRKSCRLRWFNYL 56 799********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	24.422	4	60	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.4E-19	7	55	IPR009057	Homeodomain-like
SMART	SM00717	8.0E-16	8	58	IPR001005	SANT/Myb domain
Pfam	PF00249	6.3E-17	9	56	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	8.97E-20	10	82	IPR009057	Homeodomain-like
CDD	cd00167	8.30E-11	11	56	No hit	No description
Gene3D	G3DSA:1.10.10.60	7.2E-5	56	82	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 84 aa Download sequence Send to blast
MDNTSGVKKG TWTNEEDNLL KACINKYGQG KWHLVPRRAG LNRCRKSCRL RWFNYLNPTI 60 NKERFSEDEV DMILRLQKLL KNR*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269\|PubMed:15361138}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Medtr0023s0210.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KM199562	8e-56	KM199562.1 Trifolium repens isolate Tr_RED_LEAF_DIFFUSEa R2R3 MYB protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013443301.2	2e-54	transcription factor MYB113
Swissprot	Q9FNV9	7e-34	MY113_ARATH; Transcription factor MYB113
TrEMBL	A0A072TJG3	1e-54	A0A072TJG3_MEDTR; Myb transcription factor
STRING	AES99317	2e-41	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G66370.1	3e-36	myb domain protein 113

Link Out ? help Back to Top
Phytozome	Medtr0023s0210.1
Entrez Gene	25479720

Publications ? help Back to Top
Young ND, et al. The Medicago genome provides insight into the evolution of rhizobial symbioses. Nature, 2011. 480(7378): p. 520-4 [PMID:22089132] Li T, et al. Jasmonic acid enhancement of anthocyanin accumulation is dependent on phytochrome A signaling pathway under far-red light in Arabidopsis. Biochem. Biophys. Res. Commun., 2014. 454(1): p. 78-83 [PMID:25450360] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]