![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Medtr1g029100.1 | ||||||||
| Common Name | MTR_1g029100, NF-YB19 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 91aa MW: 10363 Da PI: 4.4206 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 79.2 | 5.5e-25 | 5 | 87 | 6 | 88 |
NF-YB 6 rflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88
+Pi v+r+m+ vlP ++ i++dake++q cvs+f+ +vtse+ ++++ e++ +++ddllw++ lGfe++v +l + lk
Medtr1g029100.1 5 VRMPINHVTRVMQSVLPPDTIITDDAKELMQLCVSKFMDMVTSESFQQANVEHQMIVSADDLLWTMNRLGFEEFVRSLGKDLK 87
579************************************************************************99987665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 5.4E-23 | 3 | 89 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.68E-19 | 3 | 86 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.2E-12 | 6 | 69 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
MGEEVRMPIN HVTRVMQSVL PPDTIITDDA KELMQLCVSK FMDMVTSESF QQANVEHQMI 60 VSADDLLWTM NRLGFEEFVR SLGKDLKQCQ * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 2e-18 | 7 | 82 | 13 | 88 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Medtr1g029100.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JQ918292 | 1e-151 | JQ918292.1 Medicago truncatula nuclear transcription factor Y subunit B19 (NF-YB19) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004498435.1 | 7e-25 | nuclear transcription factor Y subunit B-3-like | ||||
| TrEMBL | I3TAX7 | 2e-60 | I3TAX7_MEDTR; Nuclear transcription factor Y protein | ||||
| STRING | XP_004498435.1 | 3e-24 | (Cicer arietinum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.3 | 1e-21 | nuclear factor Y, subunit B1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Medtr1g029100.1 |
| Entrez Gene | 25482403 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




