![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Medtr1g063160.1 | ||||||||
| Common Name | MTR_1g063160 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 180aa MW: 20243.3 Da PI: 9.8592 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 65.5 | 5.6e-21 | 10 | 57 | 2 | 49 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
r+++ rq+tfskRr+g++KKA+ELS+LC+ae+a+++fs+ ++ y +
Medtr1g063160.1 10 RVKDPNTRQITFSKRRTGLFKKANELSILCGAEAAIVVFSPGNNPYSF 57
7788899*********************************99887766 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 4.1E-33 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.83E-26 | 1 | 74 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 25.904 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00120 | 3.44E-29 | 2 | 60 | No hit | No description |
| PRINTS | PR00404 | 1.7E-19 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.6E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.7E-19 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.7E-19 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 180 aa Download sequence Send to blast |
MGRRKIKIER VKDPNTRQIT FSKRRTGLFK KANELSILCG AEAAIVVFSP GNNPYSFGHP 60 GVDFVATKYL QLEPKPSNSL ENRTSDASKM ENLNLELADV LAQIRDGEKQ AEAHDEIFKQ 120 NDVTKLSELK ELRGSYKELQ DCVKLRLNDI EISECLMLLA QDPVVGIKAK LSKNKRRKN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 9e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 9e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 9e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 9e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
| 5f28_C | 1e-17 | 1 | 92 | 1 | 93 | MEF2C |
| 5f28_D | 1e-17 | 1 | 92 | 1 | 93 | MEF2C |
| 6byy_A | 9e-18 | 1 | 79 | 1 | 80 | MEF2 CHIMERA |
| 6byy_B | 9e-18 | 1 | 79 | 1 | 80 | MEF2 CHIMERA |
| 6byy_C | 9e-18 | 1 | 79 | 1 | 80 | MEF2 CHIMERA |
| 6byy_D | 9e-18 | 1 | 79 | 1 | 80 | MEF2 CHIMERA |
| 6bz1_A | 9e-18 | 1 | 79 | 1 | 80 | MEF2 CHIMERA |
| 6bz1_B | 9e-18 | 1 | 79 | 1 | 80 | MEF2 CHIMERA |
| 6bz1_C | 9e-18 | 1 | 79 | 1 | 80 | MEF2 CHIMERA |
| 6bz1_D | 9e-18 | 1 | 79 | 1 | 80 | MEF2 CHIMERA |
| 6c9l_A | 9e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 9e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 9e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 9e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 9e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 9e-18 | 1 | 79 | 1 | 80 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Medtr1g063160.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013468149.1 | 1e-130 | agamous-like MADS-box protein AGL29 | ||||
| TrEMBL | A0A072VKM9 | 1e-128 | A0A072VKM9_MEDTR; MADS-box transcription factor family protein | ||||
| STRING | XP_004504539.1 | 5e-89 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2424 | 29 | 79 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G34440.1 | 1e-38 | AGAMOUS-like 29 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Medtr1g063160.1 |
| Entrez Gene | 25483965 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




