![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Medtr1g072790.1 | ||||||||
| Common Name | MTR_1g072790 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 177aa MW: 19488.6 Da PI: 5.6453 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 184.4 | 8.9e-58 | 28 | 123 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
reqdrflPian+srimkk+lP+n+ki+kdak+t+qecvsefisf+tseas+kcq+ekrktingddllwa+atlGfedy+eplkvyl++yreleg
Medtr1g072790.1 28 REQDRFLPIANISRIMKKALPSNGKIAKDAKDTMQECVSEFISFITSEASEKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLARYRELEG 121
89******************************************************************************************** PP
NF-YB 96 ek 97
++
Medtr1g072790.1 122 DS 123
97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.4E-54 | 24 | 135 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.04E-41 | 30 | 136 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.2E-29 | 33 | 97 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.3E-21 | 61 | 79 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 64 | 80 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.3E-21 | 80 | 98 | No hit | No description |
| PRINTS | PR00615 | 2.3E-21 | 99 | 117 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 177 aa Download sequence Send to blast |
MADAPNQCEE SHESGGEQSP RGSSSASREQ DRFLPIANIS RIMKKALPSN GKIAKDAKDT 60 MQECVSEFIS FITSEASEKC QKEKRKTING DDLLWAMATL GFEDYIEPLK VYLARYRELE 120 GDSKGSVRNS DGSGRRDQVG GPPGQNAQFV HQGSLSYIDS QVHPQHLVMP SMQNHE* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 3e-48 | 28 | 118 | 2 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 3e-48 | 28 | 118 | 2 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mtr.14376 | 0.0 | flower| root | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Medtr1g072790.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT051316 | 0.0 | BT051316.1 Medicago truncatula clone MTYF1_F2_F3_F41G-K-6 unknown mRNA. | |||
| GenBank | BT138320 | 0.0 | BT138320.1 Medicago truncatula clone JCVI-FLMt-10C19 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003590706.2 | 1e-130 | nuclear transcription factor Y subunit B-1 | ||||
| Refseq | XP_024636101.1 | 1e-130 | nuclear transcription factor Y subunit B-1 | ||||
| Swissprot | Q8VYK4 | 2e-75 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | B7FGV1 | 1e-129 | B7FGV1_MEDTR; Nuclear transcription factor Y subunit B | ||||
| STRING | AES60957 | 1e-126 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2545 | 33 | 82 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 9e-78 | nuclear factor Y, subunit B8 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Medtr1g072790.1 |
| Entrez Gene | 11429747 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




