![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Medtr1g077020.1 | ||||||||
| Common Name | MTR_1g077020 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 192aa MW: 22167.3 Da PI: 9.1052 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 101 | 8.4e-32 | 6 | 61 | 3 | 59 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
v+YkeClkNhAa++Gg+a+DGCgEfmps ge+ t +alkC AC+CHRnFHR+e e+
Medtr1g077020.1 6 VVKYKECLKNHAATIGGNAIDGCGEFMPS-GENDTLEALKCCACNCHRNFHRKEIES 61
689*************************9.8888*******************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 5.0E-22 | 7 | 63 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 1.5E-28 | 7 | 59 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 8.3E-30 | 8 | 59 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 26.54 | 9 | 58 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Gene3D | G3DSA:1.10.10.60 | 3.2E-25 | 117 | 185 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 9.87E-16 | 121 | 185 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01565 | 3.5E-24 | 124 | 181 | IPR006455 | Homeodomain, ZF-HD class |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0048574 | Biological Process | long-day photoperiodism, flowering | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0042803 | Molecular Function | protein homodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 192 aa Download sequence Send to blast |
MEKKIVVKYK ECLKNHAATI GGNAIDGCGE FMPSGENDTL EALKCCACNC HRNFHRKEIE 60 SDFNSPSQHY ANLSLIPDHN INAPFLAHFS PNNKSESTSP SDQSYYEKDF IKDVENRTEK 120 MILKKRSRTK FSKEQKEKML CFAEKAEWRI QKLEESVVQK FCQEIGIKRR ILKVWMHNNK 180 NTFAKRNLST S* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wh5_A | 5e-21 | 123 | 182 | 16 | 75 | ZF-HD homeobox family protein |
| 1wh7_A | 5e-21 | 125 | 182 | 18 | 75 | ZF-HD homeobox family protein |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Not detected in the meristem prior to exposure to long days (LDs), but after exposure to three LDs, stable accumulation on the flanks of the meristem adjacent to floral primordia, during floral induction. {ECO:0000269|PubMed:22319055}. | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in flowers and inflorescence. {ECO:0000269|PubMed:16428600}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Putative transcription factor. Probably involved in the regulation of floral induction. {ECO:0000269|PubMed:22319055}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Medtr1g077020.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by exposure to long days. {ECO:0000269|PubMed:22319055}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC139852 | 0.0 | AC139852.18 Medicago truncatula clone mth2-8n13, complete sequence. | |||
| GenBank | BT137627 | 0.0 | BT137627.1 Medicago truncatula clone JCVI-FLMt-1P8 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013468809.1 | 1e-142 | zinc-finger homeodomain protein 4 | ||||
| Swissprot | Q9M9S0 | 3e-60 | ZHD4_ARATH; Zinc-finger homeodomain protein 4 | ||||
| TrEMBL | G7L6E4 | 1e-140 | G7L6E4_MEDTR; Homeobox domain, ZF-HD class protein | ||||
| STRING | AES78583 | 1e-141 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF206 | 34 | 253 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G14440.2 | 1e-62 | homeobox protein 31 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Medtr1g077020.1 |
| Entrez Gene | 25484510 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




