![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Medtr1g083070.1 | ||||||||
| Common Name | MTR_1g083070, NF-YB11 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 128aa MW: 14464.3 Da PI: 7.4528 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 148.5 | 1.3e-46 | 4 | 95 | 3 | 94 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
e d+ lPianv+rimk+ lP nakisk++k+++qec++efisfvt+easdkc++e+rkt+ngdd++wal++lGf++y+e++ yl k+r++e
Medtr1g083070.1 4 EGDKTLPIANVGRIMKQNLPPNAKISKESKQLMQECATEFISFVTGEASDKCHKENRKTVNGDDICWALCSLGFDNYAEAIGRYLYKFRQAE 95
789**************************************************************************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.4E-45 | 3 | 118 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.33E-35 | 6 | 115 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.3E-26 | 8 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 6.0E-17 | 36 | 54 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 39 | 55 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 6.0E-17 | 55 | 73 | No hit | No description |
| PRINTS | PR00615 | 6.0E-17 | 74 | 92 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 128 aa Download sequence Send to blast |
MNDEGDKTLP IANVGRIMKQ NLPPNAKISK ESKQLMQECA TEFISFVTGE ASDKCHKENR 60 KTVNGDDICW ALCSLGFDNY AEAIGRYLYK FRQAELIRIN QNKLHETAKD KFEEDATNPS 120 TKHSSHR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-39 | 4 | 93 | 3 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-39 | 4 | 93 | 3 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mtr.26046 | 0.0 | root | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers, siliques and young rosettes. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00133 | DAP | Transfer from AT1G09030 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Medtr1g083070.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC151426 | 0.0 | AC151426.32 Medicago truncatula clone mth2-6o22, complete sequence. | |||
| GenBank | AC161241 | 0.0 | AC161241.18 Medicago truncatula clone mth2-193c3, complete sequence. | |||
| GenBank | JQ918284 | 0.0 | JQ918284.1 Medicago truncatula nuclear transcription factor Y subunit B11 (NF-YB11) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003591124.1 | 7e-93 | nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | O04027 | 1e-50 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | G7I854 | 2e-91 | G7I854_MEDTR; Nuclear transcription factor Y protein | ||||
| STRING | AES61375 | 3e-92 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 4e-53 | nuclear factor Y, subunit B4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Medtr1g083070.1 |
| Entrez Gene | 11410051 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




