![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Medtr2g014200.1 | ||||||||
| Common Name | MTR_2g014200 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 144aa MW: 16784.4 Da PI: 6.9347 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 132 | 2.1e-41 | 64 | 140 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
Cqv++C+adls ak+yh+rhkvCe hska +vl+s+l+qrfCqqCsrfhe+sefD+ krsCrrrLa+hnerrrk+++
Medtr2g014200.1 64 CQVDNCNADLSAAKQYHKRHKVCENHSKAHSVLISELQQRFCQQCSRFHEVSEFDDLKRSCRRRLAGHNERRRKSAS 140
**************************************************************************975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PIRSF | PIRSF037575 | 9.4E-61 | 6 | 143 | IPR017238 | Squamosa promoter-binding protein |
| Gene3D | G3DSA:4.10.1100.10 | 1.4E-33 | 57 | 125 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 31.445 | 61 | 138 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 1.24E-36 | 62 | 141 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 4.9E-32 | 64 | 137 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 144 aa Download sequence Send to blast |
MDGSWGEGKR IYEYREENEY EVEVEIEEEE DVSYGDDEKR KRVVTDHLYN KKGSKAGGSV 60 TPSCQVDNCN ADLSAAKQYH KRHKVCENHS KAHSVLISEL QQRFCQQCSR FHEVSEFDDL 120 KRSCRRRLAG HNERRRKSAS EYH* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 3e-35 | 56 | 137 | 3 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mtr.21285 | 0.0 | leaf | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Medtr2g014200.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT146337 | 0.0 | BT146337.1 Medicago truncatula clone JCVI-FLMt-8A17 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003593617.1 | 1e-102 | squamosa promoter-binding protein 1 | ||||
| Swissprot | Q38741 | 1e-47 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
| TrEMBL | G7ISD5 | 1e-100 | G7ISD5_MEDTR; Squamosa promoter-binding-like protein | ||||
| STRING | AES63868 | 1e-101 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF535 | 34 | 153 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G53160.2 | 2e-39 | squamosa promoter binding protein-like 4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Medtr2g014200.1 |
| Entrez Gene | 11438830 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




