PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Medtr2g026710.1

Common Name

MTR_2g026710, NF-YB13

Organism

Medicago truncatula

Taxonomic ID

3880

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago

Family

NF-YB

Protein Properties

Length: 167aa MW: 17995.2 Da PI: 5.8379

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Medtr2g026710.1	genome	Mt	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	186.2	2.5e-58	16	111	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 reqdrflPianvsrimkk+lPanakisk+aketvqecvsefisf+t+easdkcq+ekrktingddllwa++tlGfedyveplk+yl+kyre+eg Medtr2g026710.1 16 REQDRFLPIANVSRIMKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKIYLSKYREMEG 109 89******************************************************************************************** PP NF-YB 96 ek 97 ek Medtr2g026710.1 110 EK 111 97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	4.9E-56	11	124	IPR009072	Histone-fold
SuperFamily	SSF47113	9.32E-43	18	127	IPR009072	Histone-fold
Pfam	PF00808	3.2E-28	21	85	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.8E-21	49	67	No hit	No description
PROSITE pattern	PS00685	0	52	68	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.8E-21	68	86	No hit	No description
PRINTS	PR00615	1.8E-21	87	105	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 167 aa Download sequence Send to blast
MAESDNESGG GQTGCREQDR FLPIANVSRI MKKALPANAK ISKEAKETVQ ECVSEFISFI 60 TGEASDKCQK EKRKTINGDD LLWAMTTLGF EDYVEPLKIY LSKYREMEGE KSAMIGRSDQ 120 RDGNVGEGSG GVYGHGVGVP SSMMMMMGHN MYGSGSGSPS SGRSTR*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	5e-50	16	106	2	92	Transcription factor HapC (Eurofung)
4g92_B	5e-50	16	106	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Medtr2g026710.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JQ918286	0.0	JQ918286.1 Medicago truncatula nuclear transcription factor Y subunit B13 (NF-YB13) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013462945.1	1e-120	nuclear transcription factor Y subunit B-3
Swissprot	O23310	2e-70	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	I3TAX1	1e-119	I3TAX1_MEDTR; Nuclear transcription factor Y protein
STRING	XP_004486346.1	1e-93	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF591	34	150

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	1e-72	nuclear factor Y, subunit B3

Link Out ? help Back to Top
Phytozome	Medtr2g026710.1
Entrez Gene	25486265

Publications ? help Back to Top
Young ND, et al. The Medicago genome provides insight into the evolution of rhizobial symbioses. Nature, 2011. 480(7378): p. 520-4 [PMID:22089132] Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]