PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Medtr2g093810.1

Common Name

MTR_2g093810, MtrDRAFT_AC150891g8v2

Organism

Medicago truncatula

Taxonomic ID

3880

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago

Family

NAC

Protein Properties

Length: 324aa MW: 37217.8 Da PI: 8.9464

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Medtr2g093810.1	genome	Mt	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	167.8	3.5e-52	15	141	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 ppGfrFhP+deel+v+yL++k+++++l++ ++i+e+d+yk++Pw+Lpkk +e+ewyfFs+rd+ky++g r+nr+++sgyWkatg+dk+++s+ Medtr2g093810.1 15 PPGFRFHPSDEELIVHYLQNKIKSRPLPA-SIIAEIDLYKYNPWELPKKSLFGEEEWYFFSPRDRKYPNGLRPNRTAASGYWKATGTDKPIISS 107 9**************************.89***********8777899**********************************99 PP NAM 96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128 +++++g+kk Lvfy+gr pkg+ktdW+m+eyrl Medtr2g093810.1 108 cESKHIGVKKALVFYSGRPPKGVKTDWIMNEYRL 141 88899*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.09E-62	10	168	IPR003441	NAC domain
PROSITE profile	PS51005	59.513	14	168	IPR003441	NAC domain
Pfam	PF02365	2.3E-26	15	141	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 324 aa Download sequence Send to blast
MEGQQNGSKS NYTFPPGFRF HPSDEELIVH YLQNKIKSRP LPASIIAEID LYKYNPWELP 60 KKSLFGEEEW YFFSPRDRKY PNGLRPNRTA ASGYWKATGT DKPIISSCES KHIGVKKALV 120 FYSGRPPKGV KTDWIMNEYR LVDTTAKSFK LKGSMRLDDW VLCRVRNKGY SLKNLSENQE 180 NPSEPTIPLN LPRGEERPTN VNLRSDIITD YQFKDYQIIA SILVGGVIPP TENMSSLSVN 240 GSKFNNLNSV SEEGFNKANS QTTNYSLECY FNPLKRKSNE DDDQFENLIS FNSKFNSENK 300 LCESPSIDFQ KLNKFTFTER YQQ*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	3e-68	1	168	4	165	NO APICAL MERISTEM PROTEIN
1ut4_B	3e-68	1	168	4	165	NO APICAL MERISTEM PROTEIN
1ut7_A	3e-68	1	168	4	165	NO APICAL MERISTEM PROTEIN
1ut7_B	3e-68	1	168	4	165	NO APICAL MERISTEM PROTEIN
3swm_A	3e-68	1	168	7	168	NAC domain-containing protein 19
3swm_B	3e-68	1	168	7	168	NAC domain-containing protein 19
3swm_C	3e-68	1	168	7	168	NAC domain-containing protein 19
3swm_D	3e-68	1	168	7	168	NAC domain-containing protein 19
3swp_A	3e-68	1	168	7	168	NAC domain-containing protein 19
3swp_B	3e-68	1	168	7	168	NAC domain-containing protein 19
3swp_C	3e-68	1	168	7	168	NAC domain-containing protein 19
3swp_D	3e-68	1	168	7	168	NAC domain-containing protein 19
4dul_A	3e-68	1	168	4	165	NAC domain-containing protein 19
4dul_B	3e-68	1	168	4	165	NAC domain-containing protein 19
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed at the base of the inflorescence meristem and at late stages of development in petals and stamens. Up-regulated during leaf senescence. {ECO:0000269\|PubMed:16640597, ECO:0000269\|PubMed:9489703}.
Uniprot	TISSUE SPECIFICITY: Expressed in senescing leaves, petals and sepals. {ECO:0000269\|PubMed:16640597}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:16640597, ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:22184656, ECO:0000269\|PubMed:25516602}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Medtr2g093810.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269\|PubMed:22184656, ECO:0000269\|PubMed:24659488, ECO:0000269\|PubMed:25516602, ECO:0000269\|PubMed:9489703}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC150891	0.0	AC150891.3 Medicago truncatula chromosome 2 clone mth2-76a9, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003597198.1	0.0	NAC transcription factor 29
Swissprot	O49255	8e-80	NAC29_ARATH; NAC transcription factor 29
TrEMBL	Q2HSW8	0.0	Q2HSW8_MEDTR; NAC transcription factor-like protein
STRING	AES67449	0.0	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2416	29	81

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69490.1	3e-82	NAC-like, activated by AP3/PI

Link Out ? help Back to Top
Phytozome	Medtr2g093810.1
Entrez Gene	11420115

Publications ? help Back to Top
Young ND, et al. The Medicago genome provides insight into the evolution of rhizobial symbioses. Nature, 2011. 480(7378): p. 520-4 [PMID:22089132] Zhang K,Gan SS An abscisic acid-AtNAP transcription factor-SAG113 protein phosphatase 2C regulatory chain for controlling dehydration in senescing Arabidopsis leaves. Plant Physiol., 2012. 158(2): p. 961-9 [PMID:22184656] Zhang K,Halitschke R,Yin C,Liu CJ,Gan SS Salicylic acid 3-hydroxylase regulates Arabidopsis leaf longevity by mediating salicylic acid catabolism. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(36): p. 14807-12 [PMID:23959884] Shinozaki Y, et al. Expression of an AtNAP gene homolog in senescing morning glory (Ipomoea nil) petals of two cultivars with a different flower life span. J. Plant Physiol., 2014. 171(8): p. 633-8 [PMID:24709156] Xiao D, et al. SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1275-91 [PMID:26304848] Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription. Plant Cell Rep., 2016. 35(1): p. 155-66 [PMID:26441053] Seok HY, et al. Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response. Planta, 2017. 245(2): p. 329-341 [PMID:27770200]