![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Medtr3g025340.1 | ||||||||
| Common Name | MTR_3g025340 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 70aa MW: 7939.17 Da PI: 7.3421 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 40.2 | 5.1e-13 | 15 | 69 | 70 | 124 |
GRAS 70 seknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQ 124
+++ ss+ + + k+fs+++P+l fs+ ++Nqa +e++e e+ vHiiD s+++Q
Medtr3g025340.1 15 KTSLSSDDILVKKYFSKLCPFLWFSYPITNQANVESIEYETVVHIIDAHCSEPAQ 69
33458999*****************************************999998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50985 | 10.225 | 1 | 69 | IPR005202 | Transcription factor GRAS |
| Pfam | PF03514 | 1.7E-10 | 15 | 69 | IPR005202 | Transcription factor GRAS |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MCSVWKNKKV INSLKTSLSS DDILVKKYFS KLCPFLWFSY PITNQANVES IEYETVVHII 60 DAHCSEPAQ* |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Medtr3g025340.1 |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC135606 | 1e-100 | AC135606.17 Medicago truncatula clone mth2-10j1, complete sequence. | |||
| GenBank | CU182773 | 1e-100 | CU182773.4 M.truncatula DNA sequence from clone MTH2-95D13 on chromosome 3, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004513385.1 | 1e-23 | scarecrow-like protein 3 | ||||
| TrEMBL | G7IWF4 | 3e-43 | G7IWF4_MEDTR; GRAS family transcription factor | ||||
| STRING | AES69205 | 4e-44 | (Medicago truncatula) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G50420.1 | 1e-10 | scarecrow-like 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Medtr3g025340.1 |
| Entrez Gene | 11440714 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




