![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Medtr3g077240.1 | ||||||||
| Common Name | ELP1, MTR_3g077240 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 193aa MW: 20821.4 Da PI: 7.8578 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 144.3 | 3.6e-45 | 10 | 108 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94
+CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+k+l++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el
Medtr3g077240.1 10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVTKILNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVQRLQKEL 103
7********************************************************************************************* PP
DUF260 95 allke 99
+++++
Medtr3g077240.1 104 DSANA 108
99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 27.786 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 4.6E-44 | 10 | 107 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 193 aa Download sequence Send to blast |
MASSSSYNSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFA NVHKIFGASN VTKILNELLP 60 HQREDAVNSL AYEAEARVRD PVYGCVGAIS FLQRQVQRLQ KELDSANADL LRFAYNEISP 120 NSSLPPLPPL VVPASFHQSQ RQFSSRFGNG NVDGNGFYSS FPYAIPWIND TSSEDISGGV 180 GGRGGGVGGG NL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 9e-67 | 9 | 118 | 10 | 119 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 9e-67 | 9 | 118 | 10 | 119 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mtr.25864 | 0.0 | leaf | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Medtr3g077240.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC140849 | 0.0 | AC140849.8 Medicago truncatula clone mth2-17f20, complete sequence. | |||
| GenBank | AC147877 | 0.0 | AC147877.10 Medicago truncatula clone mth2-9b13, complete sequence. | |||
| GenBank | CU234113 | 0.0 | CU234113.3 M.truncatula DNA sequence from clone MTH2-16M17 on chromosome 3, complete sequence. | |||
| GenBank | JN412594 | 0.0 | JN412594.2 Medicago truncatula LOB domain protein mRNA, complete cds. | |||
| GenBank | JQ653161 | 0.0 | JQ653161.1 Medicago truncatula elongated petiolule 1 (ELP1) gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003601210.2 | 1e-140 | LOB domain-containing protein 25 | ||||
| Refseq | XP_024634900.1 | 1e-140 | LOB domain-containing protein 25 | ||||
| Refseq | XP_024634901.1 | 1e-140 | LOB domain-containing protein 25 | ||||
| Refseq | XP_024634902.1 | 1e-140 | LOB domain-containing protein 25 | ||||
| Refseq | XP_024634903.1 | 1e-140 | LOB domain-containing protein 25 | ||||
| Refseq | XP_024634904.1 | 1e-140 | LOB domain-containing protein 25 | ||||
| Swissprot | Q9FML4 | 4e-72 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | H2D439 | 1e-139 | H2D439_MEDTR; Elongated petiolule 1 | ||||
| STRING | AES71461 | 1e-136 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1091 | 34 | 112 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 1e-74 | LBD family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Medtr3g077240.1 |
| Entrez Gene | 11426990 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




