| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 32.8 | 1.7e-10 | 53 | 95 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
W+ E++ll++a ++G +W+ +a+++g ++++ c+ ++++
Medtr3g081390.1 53 DWSVHEELLLLEALDMYGFANWNGVAEHVG-TKSESRCIGHYND 95
5*****************************.***********97 PP
|
| Publications
? help Back to Top |
- Vlachonasios KE,Thomashow MF,Triezenberg SJ
Disruption mutations of ADA2b and GCN5 transcriptional adaptor genes dramatically affect Arabidopsis growth, development, and gene expression. Plant Cell, 2003. 15(3): p. 626-38 [PMID:12615937] - Sieberer T,Hauser MT,Seifert GJ,Luschnig C
PROPORZ1, a putative Arabidopsis transcriptional adaptor protein, mediates auxin and cytokinin signals in the control of cell proliferation. Curr. Biol., 2003. 13(10): p. 837-42 [PMID:12747832] - Kerschen A,Napoli CA,Jorgensen RA,Müller AE
Effectiveness of RNA interference in transgenic plants. FEBS Lett., 2004. 566(1-3): p. 223-8 [PMID:15147899] - Hark AT, et al.
Two Arabidopsis orthologs of the transcriptional coactivator ADA2 have distinct biological functions. Biochim. Biophys. Acta, 2009. 1789(2): p. 117-24 [PMID:18929690] - Anzola JM, et al.
Putative Arabidopsis transcriptional adaptor protein (PROPORZ1) is required to modulate histone acetylation in response to auxin. Proc. Natl. Acad. Sci. U.S.A., 2010. 107(22): p. 10308-13 [PMID:20479223] - Kaldis A,Tsementzi D,Tanriverdi O,Vlachonasios KE
Arabidopsis thaliana transcriptional co-activators ADA2b and SGF29a are implicated in salt stress responses. Planta, 2011. 233(4): p. 749-62 [PMID:21193996] - Vlachonasios KE,Kaldis A,Nikoloudi A,Tsementzi D
The role of transcriptional coactivator ADA2b in Arabidopsis abiotic stress responses. Plant Signal Behav, 2011. 6(10): p. 1475-8 [PMID:21897124] - Young ND, et al.
The Medicago genome provides insight into the evolution of rhizobial symbioses. Nature, 2011. 480(7378): p. 520-4 [PMID:22089132] - Heyndrickx KS,Vandepoele K
Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] - Kazama D,Kurusu T,Mitsuda N,Ohme-Takagi M,Tada Y
Involvement of elevated proline accumulation in enhanced osmotic stress tolerance in Arabidopsis conferred by chimeric repressor gene silencing technology. Plant Signal Behav, 2014. 9(3): p. e28211 [PMID:24614501] - Kim JY,Oh JE,Noh YS,Noh B
Epigenetic control of juvenile-to-adult phase transition by the Arabidopsis SAGA-like complex. Plant J., 2015. 83(3): p. 537-45 [PMID:26095998] - Kazama D, et al.
Identification of Chimeric Repressors that Confer Salt and Osmotic Stress Tolerance in Arabidopsis. Plants (Basel), 2013. 2(4): p. 769-85 [PMID:27137403] - Simon MK,Skinner DJ,Gallagher TL,Gasser CS
Integument Development in Arabidopsis Depends on Interaction of YABBY Protein INNER NO OUTER with Coactivators and Corepressors. Genetics, 2017. 207(4): p. 1489-1500 [PMID:28971961] - Lai J, et al.
The Transcriptional Coactivator ADA2b Recruits a Structural Maintenance Protein to Double-Strand Breaks during DNA Repair in Plants. Plant Physiol., 2018. 176(4): p. 2613-2622 [PMID:29463775] - Kotak J, et al.
The histone acetyltransferase GCN5 and the transcriptional coactivator ADA2b affect leaf development and trichome morphogenesis in Arabidopsis. Planta, 2018. 248(3): p. 613-628 [PMID:29846775]
|