PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Medtr3g102600.4

Common Name

MTR_3g102600

Organism

Medicago truncatula

Taxonomic ID

3880

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago

Family

ARR-B

Protein Properties

Length: 141aa MW: 16239 Da PI: 4.9939

Description

ARR-B family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Medtr3g102600.4	genome	Mt	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	67.1	3e-21	85	134	3	53
G2-like 3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53 + +W+ eLH++F+e v+qL G +kA+Pk+i +lm+v+ +t+e+v+ HLQ + Medtr3g102600.4 85 QFVWSVELHRKFLETVNQL-GVDKAVPKKIFDLMNVENITREDVATHLQAF 134 679**************.***************************87 PP
2	Response_reg	56.5	1.5e-19	9	73	44	109
ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS Response_reg 44 pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109 +Dl++ + mp+mdGl+ll+ e++lp+i+++ahge e++ +a++ Ga+dfl Kp+ eel++ Medtr3g102600.4 9 FDLVIAEVHMPDMDGLKLLELVGL-EMDLPVIMLSAHGETELVMKAISHGARDFLLKPVRLEELRN 73 9****************87754.558**********************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50110	30.619	1	79	IPR001789	Signal transduction response regulator, receiver domain
SuperFamily	SSF52172	9.68E-23	6	85	IPR011006	CheY-like superfamily
Gene3D	G3DSA:3.40.50.2300	1.5E-25	6	82	No hit	No description
CDD	cd00156	1.14E-17	9	79	No hit	No description
Pfam	PF00072	6.0E-16	9	74	IPR001789	Signal transduction response regulator, receiver domain
SuperFamily	SSF46689	1.43E-15	82	137	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.2E-19	83	134	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	3.1E-19	85	136	IPR006447	Myb domain, plants

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000160	Biological Process	phosphorelay signal transduction system
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 141 aa Download sequence Send to blast
MLQENIDMFD LVIAEVHMPD MDGLKLLELV GLEMDLPVIM LSAHGETELV MKAISHGARD 60 FLLKPVRLEE LRNIWQHVIR NKESQFVWSV ELHRKFLETV NQLGVDKAVP KKIFDLMNVE 120 NITREDVATH LQAFFQSFTL *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1irz_A	6e-17	82	134	4	56	ARR10-B
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Mtr.11681	0.0	root\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Detected in the whole plant. Predominantly expressed in roots and leaves. {ECO:0000269\|PubMed:15173562}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. {ECO:0000269\|PubMed:11574878}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Medtr3g102600.4

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JQ647414	0.0	JQ647414.1 Medicago truncatula cultivar Jemalong A17 response regulator 1 (RR1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013461736.2	7e-89	uncharacterized protein LOC25489924
Swissprot	O49397	2e-51	ARR10_ARATH; Two-component response regulator ARR10
TrEMBL	A0A072V176	8e-97	A0A072V176_MEDTR; Putative response regulator and transcription factor RR-A-type family
STRING	AES83961	9e-91	(Medicago truncatula)
STRING	AES85610	9e-91	(Medicago truncatula)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G31920.1	6e-54	response regulator 10

Link Out ? help Back to Top
Phytozome	Medtr3g102600.4
Entrez Gene	25489925

Publications ? help Back to Top
Young ND, et al. The Medicago genome provides insight into the evolution of rhizobial symbioses. Nature, 2011. 480(7378): p. 520-4 [PMID:22089132] Hill K,Schaller GE Enhancing plant regeneration in tissue culture: a molecular approach through manipulation of cytokinin sensitivity. Plant Signal Behav, 2013. 8(10): p. doi: 10.4161/psb.25709 [PMID:23887495] Ramireddy E,Chang L,Schmülling T Cytokinin as a mediator for regulating root system architecture in response to environmental cues. Plant Signal Behav, 2014. 9(1): p. e27771 [PMID:24509549] Choi SH, et al. Gene duplication of type-B ARR transcription factors systematically extends transcriptional regulatory structures in Arabidopsis. Sci Rep, 2014. 4: p. 7197 [PMID:25425016] Cortleven A, et al. Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes. Plant Physiol., 2016. 172(1): p. 464-78 [PMID:27388681] Street IH, et al. Cytokinin acts through the auxin influx carrier AUX1 to regulate cell elongation in the root. Development, 2016. 143(21): p. 3982-3993 [PMID:27697901] Wang Y,Wu Y,Yu B,Yin Z,Xia Y EXTRA-LARGE G PROTEINs Interact with E3 Ligases PUB4 and PUB2 and Function in Cytokinin and Developmental Processes. Plant Physiol., 2017. 173(2): p. 1235-1246 [PMID:27986866] Zhang TQ, et al. A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration. Plant Cell, 2017. 29(5): p. 1073-1087 [PMID:28389585] Meng WJ, et al. Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL. Plant Cell, 2017. 29(6): p. 1357-1372 [PMID:28576846] Zubo YO, et al. Cytokinin induces genome-wide binding of the type-B response regulator ARR10 to regulate growth and development in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(29): p. E5995-E6004 [PMID:28673986] Zhang F,May A,Irish VF Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL. Trends Plant Sci., 2017. 22(10): p. 815-817 [PMID:28886911] Rong XF, et al. Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis. Plant Cell Physiol., 2018. 59(4): p. 756-764 [PMID:29186581] Bustillo-Avendaño E, et al. Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis. Plant Physiol., 2018. 176(2): p. 1709-1727 [PMID:29233938]