PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Medtr4g015130.1

Common Name

MTR_4g015130

Organism

Medicago truncatula

Taxonomic ID

3880

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago

Family

MYB_related

Protein Properties

Length: 85aa MW: 9836.36 Da PI: 10.3995

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Medtr4g015130.1	genome	Mt	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	23.2	1.6e-07	2	38	11	47
HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +++ + k++G+g+W+ I++ + ++R q+ s+ qky Medtr4g015130.1 2 KFLMGLKKYGKGDWRNISHDFVTTRIQTQVASHAQKY 38 79999*******************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	12.791	1	43	IPR017930	Myb domain
TIGRFAMs	TIGR01557	1.3E-9	2	42	IPR006447	Myb domain, plants
SuperFamily	SSF46689	4.01E-8	2	44	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.3E-5	2	42	IPR009057	Homeodomain-like
CDD	cd00167	8.79E-4	2	39	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
MKFLMGLKKY GKGDWRNISH DFVTTRIQTQ VASHAQKYFI RQQNGGKDKR RSSIHDITMM 60 NLHETNSSSL EMNNILMYLI TICN*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269\|PubMed:11937495}.

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269\|PubMed:11937495, ECO:0000269\|PubMed:9118809}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Medtr4g015130.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC203224	1e-140	AC203224.21 Medicago truncatula clone mth2-152n14, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004506787.1	2e-35	transcription factor DIVARICATA-like
Refseq	XP_015950297.1	6e-35	transcription factor DIVARICATA
Swissprot	Q8S9H7	3e-30	DIV_ANTMA; Transcription factor DIVARICATA
TrEMBL	G7JMZ1	4e-56	G7JMZ1_MEDTR; MYB family transcription factor
STRING	AES86817	7e-57	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF16777	4	8

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G58900.1	1e-33	Homeodomain-like transcriptional regulator

Link Out ? help Back to Top
Phytozome	Medtr4g015130.1
Entrez Gene	11414246

Publications ? help Back to Top
Galego L,Almeida J Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers. Genes Dev., 2002. 16(7): p. 880-91 [PMID:11937495] Young ND, et al. The Medicago genome provides insight into the evolution of rhizobial symbioses. Nature, 2011. 480(7378): p. 520-4 [PMID:22089132] Almeida J,Rocheta M,Galego L Genetic control of flower shape in Antirrhinum majus. Development, 1997. 124(7): p. 1387-92 [PMID:9118809]