PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g021780.1
Common NameMTR_4g021780
Organism
Medicago truncatula
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family WRKY
Protein Properties Length: 120aa    MW: 14169.8 Da    PI: 8.0819
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g021780.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY51.71.7e-162378259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                     +Dgy+W+KYG  +vk+ e+ r+YY+Ct+++C++kkk   s+ d++     Y+++Hnh+
  Medtr4g021780.1 23 KDGYKWKKYGEEKVKN-EHKRGYYKCTHSDCQTKKKFYWSD-DGTNEYFNYTNQHNHP 78
                     7*************95.789******************999.9999***********8 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-151780IPR003657WRKY domain
PROSITE profilePS5081114.7451780IPR003657WRKY domain
SuperFamilySSF1182908.89E-151880IPR003657WRKY domain
SMARTSM007742.6E-82279IPR003657WRKY domain
PfamPF031061.5E-122378IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MVLSQENVDH NDYLSELQNR VRKDGYKWKK YGEEKVKNEH KRGYYKCTHS DCQTKKKFYW  60
SDDGTNEYFN YTNQHNHPNP QLRFVPLVAH VFPIVEQGPH QPYLAGVEVQ GDKYCLLAF*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In dry seeds, expressed in aleurone cells and embryos. Levels drop rapidly but transiently in the embryos of imbibed seeds. {ECO:0000250|UniProtKB:Q6IEQ7}.
UniprotDEVELOPMENTAL STAGE: In dry seeds, expressed in aleurone cells and embryos. Levels drop rapidly but transiently in the embryos of imbibed seeds. {ECO:0000269|PubMed:19199048}.
UniprotTISSUE SPECIFICITY: Expressed in aleurone cells. Mostly expressed in aleurone layers and leaves, and, to a lower extent, in roots, panicles and embryos. {ECO:0000250|UniProtKB:Q6IEQ7}.
UniprotTISSUE SPECIFICITY: Expressed in aleurone cells (PubMed:15618416). Mostly expressed in aleurone layers and leaves, and, to a lower extent, in roots, panicles and embryos (PubMed:26025535). {ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:26025535}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator (PubMed:26025535). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (PubMed:19199048, PubMed:26025535). Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (PubMed:15618416, PubMed:19199048, PubMed:26025535). {ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048, ECO:0000269|PubMed:26025535}.
UniProtTranscription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g021780.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:15618416, PubMed:19199048). Slightly down-regulated by gibberellic acid (GA) (PubMed:15618416). Accumulates in response to jasmonic acid (MeJA) (By similarity). {ECO:0000250|UniProtKB:Q6B6R4, ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048}.
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024640831.13e-47probable WRKY transcription factor 20
SwissprotQ6B6R42e-12WRK24_ORYSI; WRKY transcription factor WRKY24
SwissprotQ6IEQ72e-12WRK24_ORYSJ; WRKY transcription factor WRKY24
TrEMBLA0A072UHA08e-85A0A072UHA0_MEDTR; WRKY family transcription factor
STRINGAET009272e-50(Medicago truncatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.12e-14zinc-dependent activator protein-1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhang ZL, et al.
    A negative regulator encoded by a rice WRKY gene represses both abscisic acid and gibberellins signaling in aleurone cells.
    Plant Mol. Biol., 2009. 70(1-2): p. 139-51
    [PMID:19199048]
  3. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  4. Basu S,Roychoudhury A
    Expression profiling of abiotic stress-inducible genes in response to multiple stresses in rice (Oryza sativa L.) varieties with contrasting level of stress tolerance.
    Biomed Res Int, 2014. 2014: p. 706890
    [PMID:25110688]
  5. Zhang L, et al.
    Three WRKY transcription factors additively repress abscisic acid and gibberellin signaling in aleurone cells.
    Plant Sci., 2015. 236: p. 214-22
    [PMID:26025535]