![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Medtr4g045757.1 | ||||||||
| Common Name | MTR_4g045757 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 80aa MW: 9201.49 Da PI: 8.9459 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 57.5 | 3.7e-18 | 15 | 72 | 2 | 59 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHH CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnm 59
Fl+k+y ++ + ++ ++sws++++sf+v+++ +f +++LpkyFk++nf+ F+RQLn
Medtr4g045757.1 15 FLSKTYGKVDYPLTNVIVSWSATNRSFIVWNPVDFGEDLLPKYFKQNNFSNFIRQLNN 72
9********************999********************************84 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 4.1E-20 | 8 | 72 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 4.5E-6 | 11 | 74 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 1.1E-14 | 11 | 72 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 8.0E-15 | 15 | 72 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.8E-9 | 15 | 38 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.8E-9 | 53 | 65 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.8E-9 | 66 | 78 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
MEVAQGSHFN HVPPFLSKTY GKVDYPLTNV IVSWSATNRS FIVWNPVDFG EDLLPKYFKQ 60 NNFSNFIRQL NNTYTLVMI* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d8k_B | 4e-14 | 11 | 71 | 1 | 61 | Heat shock factor protein 2 |
| 5d8l_B | 4e-14 | 11 | 71 | 1 | 61 | Heat shock factor protein 2 |
| 5d8l_D | 4e-14 | 11 | 71 | 1 | 61 | Heat shock factor protein 2 |
| 5d8l_F | 4e-14 | 11 | 71 | 1 | 61 | Heat shock factor protein 2 |
| 5d8l_H | 4e-14 | 11 | 71 | 1 | 61 | Heat shock factor protein 2 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Constitutively expressed. {ECO:0000269|PubMed:7948881}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Medtr4g045757.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:7948881}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001340393.1 | 8e-27 | heat stress transcription factor 31 | ||||
| Refseq | XP_028204439.1 | 8e-27 | heat stress transcription factor A-4a-like | ||||
| Swissprot | P41151 | 6e-23 | HFA1A_ARATH; Heat stress transcription factor A-1a | ||||
| TrEMBL | A0A072UKF7 | 1e-51 | A0A072UKF7_MEDTR; Heat shock transcription factor | ||||
| STRING | GLYMA15G09280.1 | 3e-26 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G17750.1 | 2e-25 | heat shock factor 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Medtr4g045757.1 |
| Entrez Gene | 25492036 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




