![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Medtr5g007300.1 | ||||||||
| Common Name | MTR_5g007300 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 141aa MW: 16318.9 Da PI: 10.6723 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 60.2 | 4.4e-19 | 66 | 113 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+W+ eEd++lvd ++++G+g+W+ +r+ g++R++k+c++rw +yl
Medtr5g007300.1 66 KGPWSSEEDKKLVDHIQKHGPGRWRDLPRRAGLNRCGKSCRLRWTNYL 113
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 5.8E-24 | 61 | 116 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 25.054 | 61 | 117 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.2E-14 | 65 | 115 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 8.2E-17 | 66 | 113 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.12E-23 | 67 | 140 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 8.58E-11 | 68 | 113 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.5E-8 | 117 | 140 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 8.799 | 118 | 140 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 141 aa Download sequence Send to blast |
MKIIKSKLRN KINNVWFNDL MICYTEREIF KSLDDVDIIR TFTAKRSRKS AVMMTTPSNG 60 KSGLKKGPWS SEEDKKLVDH IQKHGPGRWR DLPRRAGLNR CGKSCRLRWT NYLSPDIKRG 120 KFSDEEEELI INLHSVLGNK * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 1e-20 | 64 | 140 | 25 | 100 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in rosette leaves, cauline leaves and flowers. {ECO:0000269|PubMed:8980549}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Medtr5g007300.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC126792 | 1e-153 | AC126792.15 Medicago truncatula clone mth2-8o8, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022631644.1 | 1e-46 | transcription factor MYB74 isoform X1 | ||||
| Swissprot | Q9LDR8 | 1e-41 | MY102_ARATH; Transcription factor MYB102 | ||||
| TrEMBL | G7K551 | 2e-98 | G7K551_MEDTR; Myb transcription factor | ||||
| STRING | AES93770 | 6e-99 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G16770.2 | 3e-44 | myb domain protein 9 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Medtr5g007300.1 |
| Entrez Gene | 11426855 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




