PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g032520.1
Common NameMTR_5g032520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MIKC_MADS
Protein Properties Length: 228aa    MW: 25701.2 Da    PI: 6.6897
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g032520.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.86.8e-29959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     k+ien++ rqvtfskRr g++KKAeELSvLCda+va+iifsstgkl+eys+
  Medtr5g032520.1  9 KKIENSTARQVTFSKRRRGLIKKAEELSVLCDADVALIIFSSTGKLFEYSN 59
                     68***********************************************95 PP

2K-box50.68.4e-18931712098
            K-box  20 elakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      + ++L ke+ +  +++R++ GedL+ Lsl+eLqqLe+ Le +l ++ ++K e ++++i+elq k ++l een++L++ +
  Medtr5g032520.1  93 NCSRLSKEVAQKSHQLRQMRGEDLQGLSLEELQQLEKSLEIGLGRVIETKGEKIMMEINELQTKGRQLMEENNRLKRHV 171
                      67899999999999*************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.403161IPR002100Transcription factor, MADS-box
SMARTSM004322.7E-38160IPR002100Transcription factor, MADS-box
CDDcd002651.03E-39277No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-28323IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.67E-31375IPR002100Transcription factor, MADS-box
PfamPF003193.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-283859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.5787177IPR002487Transcription factor, K-box
PfamPF014862.4E-1692171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009910Biological Processnegative regulation of flower development
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0030154Biological Processcell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0000900Molecular Functiontranslation repressor activity, nucleic acid binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MAREKIQIKK IENSTARQVT FSKRRRGLIK KAEELSVLCD ADVALIIFSS TGKLFEYSNL  60
SMREILERHH LHSKNLAKLE EPSLELQLVE NSNCSRLSKE VAQKSHQLRQ MRGEDLQGLS  120
LEELQQLEKS LEIGLGRVIE TKGEKIMMEI NELQTKGRQL MEENNRLKRH VSGMFNGKMF  180
GGVESENMVT EEGQSSESVT NVYNSTGPPQ DYESSDTSLK LGLPYAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-20169169MEF2C
5f28_B1e-20169169MEF2C
5f28_C1e-20169169MEF2C
5f28_D1e-20169169MEF2C
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.150940.0leaf| root
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During vegetative phase expressed in young leaves and apical meristem until early stage of bolting. Early in development of the inflorescence present in the coflorescence and flower primordia but not in the main apical meristem. Present throughout the floral meristem during early stages of flower development. Later disappears prior to emergence of sepal primordia. {ECO:0000269|PubMed:19656343}.
UniprotTISSUE SPECIFICITY: Detected in roots and leaves. Expressed at very low levels in flowers and siliques. Present in floral meristems. {ECO:0000269|PubMed:19656343}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00272DAPTransfer from AT2G22540Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr5g032520.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0506240.0BT050624.1 Medicago truncatula clone MTYF9_FA_FB_FC1G-H-10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003613086.11e-164MADS-box protein SVP
SwissprotQ9FVC11e-111SVP_ARATH; MADS-box protein SVP
TrEMBLG7JXQ91e-162G7JXQ9_MEDTR; MADS-box transcription factor
STRINGAES960441e-163(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89033106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-98MIKC_MADS family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP
    Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae).
    PLoS ONE, 2013. 8(6): p. e67243
    [PMID:23840638]
  3. Jaudal M, et al.
    Overexpression of Medicago SVP genes causes floral defects and delayed flowering in Arabidopsis but only affects floral development in Medicago.
    J. Exp. Bot., 2014. 65(2): p. 429-42
    [PMID:24249713]
  4. Müller-Xing R,Clarenz O,Pokorny L,Goodrich J,Schubert D
    Polycomb-Group Proteins and FLOWERING LOCUS T Maintain Commitment to Flowering in Arabidopsis thaliana.
    Plant Cell, 2014. 26(6): p. 2457-2471
    [PMID:24920331]
  5. Hwan Lee J,Sook Chung K,Kim SK,Ahn JH
    Post-translational regulation of SHORT VEGETATIVE PHASE as a major mechanism for thermoregulation of flowering.
    Plant Signal Behav, 2014. 9(4): p. e28193
    [PMID:25764420]
  6. Chen Z, et al.
    Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar.
    Transgenic Res., 2015. 24(4): p. 705-15
    [PMID:25820621]
  7. Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG
    A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch].
    BMC Plant Biol., 2015. 15: p. 41
    [PMID:25848674]
  8. Müller-Xing R,Schubert D,Goodrich J
    Non-inductive conditions expose the cryptic bract of flower phytomeres in Arabidopsis thaliana.
    Plant Signal Behav, 2015. 10(4): p. e1010868
    [PMID:25924005]
  9. Marín-González E, et al.
    SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures.
    Plant Physiol., 2015. 169(2): p. 1214-24
    [PMID:26243615]
  10. Bechtold U, et al.
    Time-Series Transcriptomics Reveals That AGAMOUS-LIKE22 Affects Primary Metabolism and Developmental Processes in Drought-Stressed Arabidopsis.
    Plant Cell, 2016. 28(2): p. 345-66
    [PMID:26842464]
  11. Fernández V,Takahashi Y,Le Gourrierec J,Coupland G
    Photoperiodic and thermosensory pathways interact through CONSTANS to promote flowering at high temperature under short days.
    Plant J., 2016. 86(5): p. 426-40
    [PMID:27117775]
  12. Wilson DC,Kempthorne CJ,Carella P,Liscombe DK,Cameron RK
    Age-Related Resistance in Arabidopsis thaliana Involves the MADS-Domain Transcription Factor SHORT VEGETATIVE PHASE and Direct Action of Salicylic Acid on Pseudomonas syringae.
    Mol. Plant Microbe Interact., 2017. 30(11): p. 919-929
    [PMID:28812948]
  13. Zou YP, et al.
    Adaptation of Arabidopsis thaliana to the Yangtze River basin.
    Genome Biol., 2017. 18(1): p. 239
    [PMID:29284515]
  14. Richter R, et al.
    Floral regulators FLC and SOC1 directly regulate expression of the B3-type transcription factor TARGET OF FLC AND SVP 1 at the Arabidopsis shoot apex via antagonistic chromatin modifications.
    PLoS Genet., 2019. 15(4): p. e1008065
    [PMID:30946745]