![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Medtr5g066180.1 | ||||||||
| Common Name | MTR_5g066180 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 226aa MW: 25470.4 Da PI: 9.0525 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 89.3 | 1.9e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i+n + rqvtfskRr gi+KKAeELS+LCdaev ++ifs+tgklyey+s
Medtr5g066180.1 9 KKIDNATARQVTFSKRRRGIFKKAEELSILCDAEVGLVIFSTTGKLYEYAS 59
68***********************************************86 PP
| |||||||
| 2 | K-box | 43.6 | 1.2e-15 | 89 | 170 | 18 | 99 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99
++ a L+ke+ +++R ++ ed e L+l+ LqqLe+ Le++lk++ + K++ +l++i+ l++ke +l+eenk L++k++
Medtr5g066180.1 89 KNMPAELNKEVADRTQQLRGMKSEDFEGLNLEGLQQLEKSLESGLKRVIEMKEKKILNEIKALRMKEIMLEEENKHLKQKMA 170
555577888888888999*************************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.3E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 30.249 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 4.62E-40 | 2 | 74 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.0E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.09E-31 | 3 | 75 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.6E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.0E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.0E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 11.512 | 85 | 175 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 9.2E-14 | 92 | 169 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0000060 | Biological Process | protein import into nucleus, translocation | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
| GO:0048438 | Biological Process | floral whorl development | ||||
| GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005737 | Cellular Component | cytoplasm | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 226 aa Download sequence Send to blast |
MARQKIKIKK IDNATARQVT FSKRRRGIFK KAEELSILCD AEVGLVIFST TGKLYEYASS 60 NMKDIITRYG QQSHHITKLD KPLQVQVEKN MPAELNKEVA DRTQQLRGMK SEDFEGLNLE 120 GLQQLEKSLE SGLKRVIEMK EKKILNEIKA LRMKEIMLEE ENKHLKQKMA MLSMGKSPIF 180 GDSDITMQEN VSAESMNNVS SCNSGPSLED DSSDTSLKLG LPFPN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 3e-20 | 1 | 98 | 1 | 91 | MEF2C |
| 5f28_B | 3e-20 | 1 | 98 | 1 | 91 | MEF2C |
| 5f28_C | 3e-20 | 1 | 98 | 1 | 91 | MEF2C |
| 5f28_D | 3e-20 | 1 | 98 | 1 | 91 | MEF2C |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mtr.12256 | 0.0 | glandular trichome| leaf | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During vegetative phase expressed in young leaves and apical meristem until early stage of bolting. Early in development of the inflorescence present in the coflorescence and flower primordia but not in the main apical meristem. Present throughout the floral meristem during early stages of flower development. Later disappears prior to emergence of sepal primordia. {ECO:0000269|PubMed:19656343}. | |||||
| Uniprot | TISSUE SPECIFICITY: Detected in roots and leaves. Expressed at very low levels in flowers and siliques. Present in floral meristems. {ECO:0000269|PubMed:19656343}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Medtr5g066180.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT051352 | 0.0 | BT051352.1 Medicago truncatula clone MTYF1_F2_F3_F41G-A-16 unknown mRNA. | |||
| GenBank | BT149637 | 0.0 | BT149637.1 Medicago truncatula clone JCVI-FLMt-10G13 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003615289.2 | 1e-165 | MADS-box protein AGL24 isoform X2 | ||||
| Swissprot | Q9FVC1 | 4e-71 | SVP_ARATH; MADS-box protein SVP | ||||
| TrEMBL | G7KBL2 | 1e-163 | G7KBL2_MEDTR; MADS-box transcription factor | ||||
| STRING | XP_004490446.1 | 1e-117 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF890 | 33 | 106 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G22540.1 | 2e-65 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Medtr5g066180.1 |
| Entrez Gene | 11437402 |




