![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Medtr5g066960.1 | ||||||||
| Common Name | MTR_5g066960 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 62aa MW: 6878.05 Da PI: 11.3251 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 85.9 | 2.3e-27 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
ri+n++ rqvtfskRrng+lKKA+EL +LCdaev v+ifsst kly+++s
Medtr5g066960.1 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVMIFSSTAKLYDFAS 59
8***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.511 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 8.1E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 8.76E-28 | 2 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.51E-36 | 2 | 60 | No hit | No description |
| PRINTS | PR00404 | 6.5E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.7E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.5E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.5E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 62 aa Download sequence Send to blast |
MGRGKIQIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVMIFSS TAKLYDFAST 60 R* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 2e-20 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_B | 2e-20 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_C | 2e-20 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_D | 2e-20 | 1 | 60 | 1 | 60 | MEF2C |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mtr.15720 | 1e-100 | root | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Specifically expressed in roots, mostly in lateral roots (LR) primordia, young emerging LRs, apex and base of LRs, apex of the primary root, and in the stele. Barely detectable in shoots. {ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Required for root plasticity in response to nitrate, NO(3)(-). Promotes lateral root growth in a NRT1.1-dependent manner. {ECO:0000269|PubMed:15667327, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Medtr5g066960.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by nitrate in root cell culture, (PubMed:9430595, PubMed:17148611). In roots, seems induced by nitrogen (N) deprivation (e.g. nitrate free medium) but rapidly repressed by N re-supply (e.g. nitrate, glutamine and ammonium) (PubMed:16021502). Slight repression in shoots during nitrogen (N) deprivation. {ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CT485795 | 2e-99 | CT485795.2 Medicago truncatula chromosome 5 clone mte1-33h11, COMPLETE SEQUENCE. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003615360.2 | 1e-35 | MADS-box transcription factor 23 isoform X4 | ||||
| Refseq | XP_024640181.1 | 2e-35 | MADS-box transcription factor 23 isoform X1 | ||||
| Refseq | XP_024640183.1 | 2e-35 | MADS-box transcription factor 23 isoform X3 | ||||
| Swissprot | Q9SI38 | 2e-31 | ANR1_ARATH; MADS-box transcription factor ANR1 | ||||
| TrEMBL | G7JYJ6 | 5e-36 | G7JYJ6_MEDTR; MADS-box transcription factor family protein | ||||
| STRING | AES98316 | 1e-36 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G14210.1 | 7e-34 | AGAMOUS-like 44 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Medtr5g066960.1 |
| Entrez Gene | 11423801 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




