PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g046600.1
Common NameMTR_6g046600
Organism
Medicago truncatula
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family WRKY
Protein Properties Length: 119aa    MW: 13802.8 Da    PI: 9.4045
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g046600.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY551.6e-1715581559
                     -TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY 15 vkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                     ++ se+ rsYY+Ct+++ pvkkkvers  d+++ ei+Y+geHnh 
  Medtr6g046600.1 15 MERSEYLRSYYKCTYPNYPVKKKVERSL-DGEIAEIVYKGEHNHG 58
                     56799***********************.***************5 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031065.5E-121457IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.6E-141460IPR003657WRKY domain
SMARTSM007741.1E-91459IPR003657WRKY domain
PROSITE profilePS5081110.8891560IPR003657WRKY domain
SuperFamilySSF1182903.14E-121560IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MLIDLRMMDI TRENMERSEY LRSYYKCTYP NYPVKKKVER SLDGEIAEIV YKGEHNHGKP  60
QHQKRNSGAT SGMTSDGMVQ DKVWSIPQFF NPSSSSVLLT LKHPCRESVQ RTRFLELM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.72461e-107leaf| seed
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In dry seeds, expressed in aleurone cells and embryos. Levels drop rapidly but transiently in the embryos of imbibed seeds. {ECO:0000269|PubMed:19199048}.
UniprotTISSUE SPECIFICITY: Expressed in aleurone cells (PubMed:15618416). Mostly expressed in aleurone layers and leaves, and, to a lower extent, in roots, panicles and embryos (PubMed:26025535). {ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:26025535}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator (PubMed:26025535). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (PubMed:19199048, PubMed:26025535). Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (PubMed:15618416, PubMed:19199048, PubMed:26025535). {ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048, ECO:0000269|PubMed:26025535}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr6g046600.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:15618416, PubMed:19199048). Slightly down-regulated by gibberellic acid (GA) (PubMed:15618416). Accumulates in response to jasmonic acid (MeJA) (By similarity). {ECO:0000250|UniProtKB:Q6B6R4, ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1375530.0AC137553.45 Medicago truncatula chromosome 6 clone mth2-20p12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003625561.13e-39WRKY transcription factor 44
RefseqXP_024625882.13e-39WRKY transcription factor 44
RefseqXP_024625883.13e-39WRKY transcription factor 44
RefseqXP_024625884.13e-39WRKY transcription factor 44
SwissprotQ6IEQ79e-21WRK24_ORYSJ; WRKY transcription factor WRKY24
TrEMBLG7KKK73e-84G7KKK7_MEDTR; Putative transcription factor WRKY family
STRINGAES755435e-85(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67903450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-19WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhang ZL, et al.
    A negative regulator encoded by a rice WRKY gene represses both abscisic acid and gibberellins signaling in aleurone cells.
    Plant Mol. Biol., 2009. 70(1-2): p. 139-51
    [PMID:19199048]
  3. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  4. Basu S,Roychoudhury A
    Expression profiling of abiotic stress-inducible genes in response to multiple stresses in rice (Oryza sativa L.) varieties with contrasting level of stress tolerance.
    Biomed Res Int, 2014. 2014: p. 706890
    [PMID:25110688]
  5. Zhang L, et al.
    Three WRKY transcription factors additively repress abscisic acid and gibberellin signaling in aleurone cells.
    Plant Sci., 2015. 236: p. 214-22
    [PMID:26025535]