![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Medtr7g028710.1 | ||||||||
| Common Name | MTR_7g028415, MTR_7g028710 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 172aa MW: 19591 Da PI: 9.0207 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 104.7 | 4.9e-33 | 92 | 150 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H+h+
Medtr7g028710.1 92 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGVHTHP 150
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 1.0E-33 | 77 | 150 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 4.71E-30 | 84 | 151 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 29.895 | 87 | 152 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.5E-39 | 92 | 151 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 5.7E-27 | 93 | 150 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter | ||||
| GO:0010055 | Biological Process | atrichoblast differentiation | ||||
| GO:0032107 | Biological Process | regulation of response to nutrient levels | ||||
| GO:0043620 | Biological Process | regulation of DNA-templated transcription in response to stress | ||||
| GO:0048527 | Biological Process | lateral root development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 172 aa Download sequence Send to blast |
MENNYSMLFP CPPSSSYQIP TSGLNGQSSN AFLGLKPTNN EISVTHDDHE DVKGEEGSVN 60 VIIDQQDVKK KGEKKAKKPK YAFQTRSQVD ILDDGYRWRK YGQKAVKNNK FPRSYYRCTH 120 QGCNVKKQVQ RLTKDEGVVV TTYEGVHTHP IEKTTDNFEH ILSQMQIYTP F* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 3e-27 | 82 | 151 | 7 | 76 | Probable WRKY transcription factor 4 |
| 2lex_A | 3e-27 | 82 | 151 | 7 | 76 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mtr.17348 | 0.0 | leaf| root | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00506 | DAP | Transfer from AT5G13080 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Medtr7g028710.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT142124 | 1e-102 | BT142124.1 Lotus japonicus clone JCVI-FLLj-20G12 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013447931.1 | 1e-127 | probable WRKY transcription factor 75 | ||||
| Refseq | XP_013447948.1 | 1e-127 | probable WRKY transcription factor 75 | ||||
| Swissprot | Q9FYA2 | 1e-56 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
| TrEMBL | A0A072TYN7 | 1e-126 | A0A072TYN7_MEDTR; Putative transcription factor WRKY family | ||||
| STRING | XP_004514784.1 | 4e-87 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1156 | 34 | 110 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13080.1 | 2e-58 | WRKY DNA-binding protein 75 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Medtr7g028710.1 |
| Entrez Gene | 25497756 | 25497771 |




