![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Medtr7g028905.1 | ||||||||
| Common Name | MTR_7g028905 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 118aa MW: 13461.4 Da PI: 9.0302 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 124.4 | 5.5e-39 | 5 | 105 | 1 | 101 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94
+CaaCk +rr+C++dC+++pyfp ++p++f vh+++G snv k+l++lp+ r++a++s++ eA++r++dPvyG+vg+i+kl+qq++ +++el
Medtr7g028905.1 5 RCAACKSQRRRCPPDCIFSPYFPPNDPQRFSSVHRIYGGSNVGKMLQQLPHYVRHQAANSMYLEAQCRVQDPVYGCVGIISKLSQQIQDTEVEL 98
6********************************************************************************************* PP
DUF260 95 allkeel 101
a++k+++
Medtr7g028905.1 99 AKIKTQI 105
**99875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 23.603 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 6.8E-39 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0016020 | Cellular Component | membrane | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MIYSRCAACK SQRRRCPPDC IFSPYFPPND PQRFSSVHRI YGGSNVGKML QQLPHYVRHQ 60 AANSMYLEAQ CRVQDPVYGC VGIISKLSQQ IQDTEVELAK IKTQIAYHKL HNQQFDS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 8e-35 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 8e-35 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Medtr7g028905.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CU179894 | 3e-53 | CU179894.1 Medicago truncatula chromosome 5 clone mth4-21m22, COMPLETE SEQUENCE. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013447968.1 | 1e-83 | LOB domain-containing protein 24 | ||||
| Swissprot | P59468 | 5e-47 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
| TrEMBL | A0A072U820 | 3e-82 | A0A072U820_MEDTR; Lateral organ boundaries (LOB) domain protein | ||||
| STRING | AET00525 | 2e-68 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF3697 | 30 | 66 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G26660.1 | 2e-49 | LOB domain-containing protein 24 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Medtr7g028905.1 |
| Entrez Gene | 25497793 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




