![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Medtr7g100880.1 | ||||||||
| Common Name | MTR_7g100880 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 85aa MW: 9267.05 Da PI: 10.6064 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 132.1 | 1.4e-41 | 19 | 84 | 5 | 70 |
S1FA 5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
k+ ++G+nPGl+vllv+gglll+fl+gny+lyvyaqk+lPPrkkkP+skkk+k+e+lkqGv++PGe
Medtr7g100880.1 19 KAGSQGFNPGLVVLLVIGGLLLTFLIGNYALYVYAQKALPPRKKKPISKKKMKKERLKQGVSAPGE 84
56789************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 1.3E-39 | 21 | 84 | IPR006779 | DNA binding protein S1FA |
| ProDom | PD019013 | 1.0E-4 | 22 | 84 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 85 aa Download sequence Send to blast |
MADEFEFGDK IPPSFDRMKA GSQGFNPGLV VLLVIGGLLL TFLIGNYALY VYAQKALPPR 60 KKKPISKKKM KKERLKQGVS APGE* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mtr.24675 | 1e-111 | glandular trichome| root| seed | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Medtr7g100880.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT141610 | 1e-140 | BT141610.1 Medicago truncatula clone JCVI-FLMt-6A8 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003625597.1 | 6e-54 | DNA-binding protein S1FA | ||||
| Swissprot | Q42337 | 9e-14 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
| Swissprot | Q7XLX6 | 8e-14 | S1FA2_ORYSJ; DNA-binding protein S1FA2 | ||||
| TrEMBL | G7L1S4 | 1e-52 | G7L1S4_MEDTR; DNA-binding protein S1FA | ||||
| STRING | AES81815 | 2e-53 | (Medicago truncatula) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF5409 | 33 | 55 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G09735.1 | 1e-06 | S1FA-like DNA-binding protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Medtr7g100880.1 |
| Entrez Gene | 11436340 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




