PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Medtr7g100905.2

Common Name

MTR_7g100905

Organism

Medicago truncatula

Taxonomic ID

3880

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago

Family

S1Fa-like

Protein Properties

Length: 69aa MW: 7382.96 Da PI: 11.0234

Description

S1Fa-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Medtr7g100905.2	genome	Mt	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	S1FA	133.7	4.4e-42	5	68	7	70
S1FA 7 eakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 ++G+nPGlivllv+gglll+fl+gny+lyvyaqk+lPPrkkkPvskkk+k+e+lkqGv++PGe Medtr7g100905.2 5 GSQGFNPGLIVLLVIGGLLLTFLIGNYALYVYAQKALPPRKKKPVSKKKMKKERLKQGVSAPGE 68 579************************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04689	1.5E-40	5	68	IPR006779	DNA binding protein S1FA

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0016021	Cellular Component	integral component of membrane
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 69 aa Download sequence Send to blast
MINAGSQGFN PGLIVLLVIG GLLLTFLIGN YALYVYAQKA LPPRKKKPVS KKKMKKERLK 60 QGVSAPGE*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Mtr.4128	1e-106	flower\| leaf\| root\| seed

Functional Description ? help Back to Top
Source	Description
UniProt	DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Medtr7g100905.2

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC124963	1e-108	AC124963.32 Medicago truncatula clone mth2-24f5, complete sequence.
GenBank	BT147731	1e-108	BT147731.1 Medicago truncatula clone JCVI-FLMt-2O21 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013449980.1	4e-39	DNA-binding protein S1FA
Swissprot	Q7XLX6	4e-14	S1FA2_ORYSJ; DNA-binding protein S1FA2
TrEMBL	A0A072U2T7	2e-39	A0A072U2T7_MEDTR; DNA-binding protein S1FA
STRING	AES81817	3e-36	(Medicago truncatula)

Link Out ? help Back to Top
Phytozome	Medtr7g100905.2
Entrez Gene	25499308

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Young ND, et al. The Medicago genome provides insight into the evolution of rhizobial symbioses. Nature, 2011. 480(7378): p. 520-4 [PMID:22089132]