PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g017480.1
Organism
Medicago truncatula
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 53aa    MW: 5850.72 Da    PI: 9.394
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g017480.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.82.2e-121452139
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39
                     rg W++eEde+l+++ + +G g+W+++++  g+ R++k+
  Medtr8g017480.1 14 RGLWSPEEDEKLIKYSTTYGHGCWSSVPKLAGLQRCGKS 52
                     789*****************************99**985 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-17652IPR009057Homeodomain-like
PROSITE profilePS5129416.011952IPR017930Myb domain
SuperFamilySSF466891.72E-10951IPR009057Homeodomain-like
PfamPF002499.6E-101452IPR001005SANT/Myb domain
CDDcd001673.04E-61752No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 53 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLIKYST TYGHGCWSSV PKLAGLQRCG KS*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in anthers early during endothecial development, with maximal expression during pollen mitosis I and bicellular stages. {ECO:0000269|PubMed:17329564}.
UniprotTISSUE SPECIFICITY: Highly expressed in flowers. {ECO:0000269|PubMed:12753590}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269|PubMed:12753590, ECO:0000269|PubMed:17147638, ECO:0000269|PubMed:17329564}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr8g017480.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by auxin. {ECO:0000269|PubMed:23410518}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017411251.13e-32PREDICTED: transcription factor MYB21
RefseqXP_017411252.13e-32PREDICTED: transcription factor MYB21
SwissprotQ9SPG33e-25MYB26_ARATH; Transcription factor MYB26
TrEMBLA0A396GFT01e-31A0A396GFT0_MEDTR; Putative transcription factor MYB-HB-like family
STRINGXP_004510395.12e-31(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1750046
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.21e-30myb domain protein 26
Publications ? help Back to Top
  1. Coego A, et al.
    The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression.
    Plant J., 2014. 77(6): p. 944-53
    [PMID:24456507]
  2. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  3. Ghelli R, et al.
    A Newly Identified Flower-Specific Splice Variant of AUXIN RESPONSE FACTOR8 Regulates Stamen Elongation and Endothecium Lignification in Arabidopsis.
    Plant Cell, 2018. 30(3): p. 620-637
    [PMID:29514943]