PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Migut.B01849.1.p

Organism

Mimulus guttatus

Taxonomic ID

4155

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe

Family

MYB_related

Protein Properties

Length: 85aa MW: 9852.12 Da PI: 8.2329

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Migut.B01849.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	29.5	1.8e-09	28	68	4	46
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 ++++E++++ + +k+ G + W++Ia +++ gRt+ ++ +w + Migut.B01849.1.p 28 MSEQEQDIIFRMHKLVGDK-WELIAGRIP-GRTAQEIERFWIN 68 799************99.*****.*********87 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	2.6E-6	24	72	IPR001005	SANT/Myb domain
CDD	cd00167	2.27E-7	27	68	No hit	No description
Pfam	PF00249	1.7E-8	28	68	IPR001005	SANT/Myb domain
PROSITE profile	PS50090	5.993	29	66	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	4.6E-12	29	68	IPR009057	Homeodomain-like
SuperFamily	SSF46689	2.28E-8	29	69	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
MDNNNKTMVQ TFSSSQEDRS NGCELTSMSE QEQDIIFRMH KLVGDKWELI AGRIPGRTAQ 60 EIERFWINCD TFKVNRVPQT TRKK*

Functional Description ? help Back to Top
Source	Description
UniProt	MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation by direct binding to the cis-acting regulatory elements of GL1, thus suppressing the expression of GL1. {ECO:0000269\|PubMed:17933793}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Migut.B01849.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012844007.1	1e-57	PREDICTED: MYB-like transcription factor ETC3
Swissprot	D3GKW6	4e-20	TCL1_ARATH; MYB-like transcription factor TCL1
TrEMBL	A0A2G9I9T4	1e-21	A0A2G9I9T4_9LAMI; Uncharacterized protein

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA11707	18	24

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G01060.2	1e-23	CAPRICE-like MYB3

Link Out ? help Back to Top
Phytozome	Migut.B01849.1.p

Publications ? help Back to Top
Alexandrov NN, et al. Features of Arabidopsis genes and genome discovered using full-length cDNAs. Plant Mol. Biol., 2006. 60(1): p. 69-85 [PMID:16463100] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zheng K, et al. Ectopic expression of R3 MYB transcription factor gene OsTCL1 in Arabidopsis, but not rice, affects trichome and root hair formation. Sci Rep, 2016. 6: p. 19254 [PMID:26758286] Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells. Plant J., 2016. 88(5): p. 762-774 [PMID:27496682] Tian H, et al. NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1. Plant Physiol., 2017. 174(4): p. 2363-2375 [PMID:28649093]