![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Migut.D01622.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 174aa MW: 20262.3 Da PI: 10.2207 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 92.7 | 1.8e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtfskRr g+lKKA+E+SvLCda+v +i+fs++gkl ey+s
Migut.D01622.1.p 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDADVGLIVFSTKGKLSEYAS 59
79***********************************************86 PP
| |||||||
| 2 | K-box | 70.4 | 5.5e-24 | 81 | 161 | 7 | 87 |
K-box 7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekel 87
k+ + + +s++ e+akLk+++e Lqr+q+h++G++L++Ls +e q+Le+ e slk+ R++ n+l+ e+i elqkk +++
Migut.D01622.1.p 81 KEPDLESPASWSLEHAKLKARMEVLQRNQKHYMGDELDNLSTRERQNLEHPPEGSLKHTRARENQLMNESITELQKKVRKI 161
4445566789*******************************************************************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.399 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 7.0E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 4.41E-40 | 2 | 76 | No hit | No description |
| SuperFamily | SSF55455 | 1.01E-33 | 2 | 91 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.5E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 11.323 | 88 | 173 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 1.5E-16 | 89 | 161 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 174 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD ADVGLIVFST KGKLSEYASD 60 SSMERILERY DRYSYAEKKM KEPDLESPAS WSLEHAKLKA RMEVLQRNQK HYMGDELDNL 120 STRERQNLEH PPEGSLKHTR ARENQLMNES ITELQKKVRK ITYFTFTVTL LTM* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 1e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 1e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 1e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 1e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6byy_A | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_B | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_C | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_D | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_A | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_B | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_C | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_D | 2e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6c9l_A | 1e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 1e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 1e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 1e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 1e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 1e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Migut.D01622.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012853820.1 | 1e-103 | PREDICTED: agamous-like MADS-box protein AGL8 homolog | ||||
| Swissprot | Q40170 | 2e-85 | AGL8_SOLLC; Agamous-like MADS-box protein AGL8 homolog | ||||
| TrEMBL | A0A2G9H572 | 2e-89 | A0A2G9H572_9LAMI; MADS box transcription factor | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA499 | 23 | 97 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G60910.1 | 6e-76 | AGAMOUS-like 8 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Migut.D01622.1.p |




