![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Migut.F00051.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 158aa MW: 18165.3 Da PI: 10.0431 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 106.3 | 1.6e-33 | 77 | 135 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d +v++tYeg+H+h+
Migut.F00051.1.p 77 LDDGYRWRKYGQKAVKNNTFPRSYYRCTHQGCNVKKQVQRLSRDDAIVVTTYEGKHTHP 135
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 3.7E-35 | 62 | 136 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 6.41E-30 | 70 | 136 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 30.767 | 72 | 137 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.5E-39 | 77 | 136 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.9E-27 | 78 | 135 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter | ||||
| GO:0010055 | Biological Process | atrichoblast differentiation | ||||
| GO:0032107 | Biological Process | regulation of response to nutrient levels | ||||
| GO:0043620 | Biological Process | regulation of DNA-templated transcription in response to stress | ||||
| GO:0048527 | Biological Process | lateral root development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 158 aa Download sequence Send to blast |
MVSSTNSYYN NGYLDGFTSF KRDTPYTAAM ENDDDQKKSS PSVLGINTDQ KKKGTGGEKK 60 IRNPRFAFKT RSQVDILDDG YRWRKYGQKA VKNNTFPRSY YRCTHQGCNV KKQVQRLSRD 120 DAIVVTTYEG KHTHPVQKTT DNFEQILNQM QIYLPTN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 4e-28 | 67 | 134 | 7 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 4e-28 | 67 | 134 | 7 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00506 | DAP | Transfer from AT5G13080 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Migut.F00051.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012844420.1 | 1e-115 | PREDICTED: probable WRKY transcription factor 43 | ||||
| Swissprot | Q9FYA2 | 1e-50 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
| TrEMBL | A0A022S0K6 | 5e-91 | A0A022S0K6_ERYGU; Uncharacterized protein | ||||
| STRING | Migut.F00051.1.p | 1e-115 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA2204 | 24 | 61 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13080.1 | 6e-53 | WRKY DNA-binding protein 75 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Migut.F00051.1.p |




