| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | NAM | 164.1 | 5.1e-51 | 21 | 148 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91
l+pGfrFhPtdeelv +yL++k+ +k++++ e+++e+d+yk+ePw++ + ++k+++ ewyfFs+ d+ky +g+r nrat +gyWkatgkd+
Migut.F01914.1.p 21 LAPGFRFHPTDEELVRYYLRRKACRKPFRF-EAVSEIDVYKSEPWEIAEysSTKSRDLEWYFFSPVDRKYGNGSRLNRATGQGYWKATGKDRY 112
579*************************99.89**************84235555666*********************************** PP
NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
v + k++++g+kktLvf++grap+g++t+Wvmheyrl
Migut.F01914.1.p 113 VRH-KDQTIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 148
***.8999***************************98 PP
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 1ut4_A | 1e-48 | 21 | 171 | 17 | 165 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 1e-48 | 21 | 171 | 17 | 165 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 1e-48 | 21 | 171 | 17 | 165 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 1e-48 | 21 | 171 | 17 | 165 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 1e-48 | 21 | 171 | 20 | 168 | NAC domain-containing protein 19 |
| 3swm_B | 1e-48 | 21 | 171 | 20 | 168 | NAC domain-containing protein 19 |
| 3swm_C | 1e-48 | 21 | 171 | 20 | 168 | NAC domain-containing protein 19 |
| 3swm_D | 1e-48 | 21 | 171 | 20 | 168 | NAC domain-containing protein 19 |
| 3swp_A | 1e-48 | 21 | 171 | 20 | 168 | NAC domain-containing protein 19 |
| 3swp_B | 1e-48 | 21 | 171 | 20 | 168 | NAC domain-containing protein 19 |
| 3swp_C | 1e-48 | 21 | 171 | 20 | 168 | NAC domain-containing protein 19 |
| 3swp_D | 1e-48 | 21 | 171 | 20 | 168 | NAC domain-containing protein 19 |
| 4dul_A | 1e-48 | 21 | 171 | 17 | 165 | NAC domain-containing protein 19 |
| 4dul_B | 1e-48 | 21 | 171 | 17 | 165 | NAC domain-containing protein 19 |
| Search in ModeBase |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC050 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). Regulates siRNA-dependent post-transcriptional gene silencing (PTGS) through SGS3 expression modulation (PubMed:28207953). Required during pollen development (PubMed:19237690). {ECO:0000269|PubMed:19237690, ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990, ECO:0000269|PubMed:28207953}. |
| UniProt | Transcriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC051/NAC052 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). {ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990}. |
