PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.H01775.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 117aa    MW: 13738.6 Da    PI: 9.5414
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.H01775.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY62.47.8e-20965360
                      -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY  3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60
                      D+y W  YG+++v g++fp  YYrC+++gC+v+kk  rs   ++++ei+Y+++H+h+k
  Migut.H01775.2.p  9 DEYLWIQYGKRVVGGNDFPVRYYRCSYPGCTVRKKCVRSP-TGEITEIVYRDSHHHPK 65
                      9***************************************.9**************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081116.386266IPR003657WRKY domain
SuperFamilySSF1182904.18E-16466IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-16566IPR003657WRKY domain
SMARTSM007741.3E-10765IPR003657WRKY domain
PfamPF031062.2E-14964IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MTGHTLPYDE YLWIQYGKRV VGGNDFPVRY YRCSYPGCTV RKKCVRSPTG EITEIVYRDS  60
HHHPKPHLID IDLSFATRDG GKSIRRLQIR YYDLRWQAQP WYPSCRESRN IIFSGP*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-TTGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Involved in defense responses. Required for resistance to the necrotrophic fungal pathogen B.cinerea (PubMed:17059405, PubMed:21990940). Regulates the antagonistic relationship between defense pathways mediating responses to the bacterial pathogen P. syringae and the necrotrophic pathogen B.cinerea (PubMed:17059405). Required for the phytoalexin camalexin synthesis following infection with B.cinerea. Acts as positive regulator of the camalexin biosynthetic genes PAD3 (CYP71B15) and CYP71A13 by binding to their promoters (PubMed:21498677, PubMed:22392279). Acts downstream of MPK3 and MPK6 in reprogramming the expression of camalexin biosynthetic genes, which drives the metabolic flow to camalexin production (PubMed:21498677). Functions with WRKY25 as positive regulator of salt stress response and abscisic acid (ABA) signaling (PubMed:18839316). Functions with WRKY25 and WRKY26 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). The DNA-binding activity of WRKY33 is increased by SIB1 and SIB2 (PubMed:21990940). {ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:21336597, ECO:0000269|PubMed:21498677, ECO:0000269|PubMed:21990940, ECO:0000269|PubMed:22392279}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.H01775.2.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt stress (PubMed:18839316). Induced by infection with the necrotrophic fungal pathogen B.cinerea (PubMed:17059405, PubMed:21498677, PubMed:21990940). Induced by infection with the bacterial pathogen P.syringae pv. tomato DC3000 (PubMed:17059405). {ECO:0000269|PubMed:17059405, ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:21498677, ECO:0000269|PubMed:21990940}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009804327.18e-18PREDICTED: probable WRKY transcription factor 20 isoform X1
RefseqXP_019194097.17e-18PREDICTED: probable WRKY transcription factor 20
RefseqXP_019264295.18e-18PREDICTED: probable WRKY transcription factor 20
SwissprotQ8S8P55e-15WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A1U7YJR72e-16A0A1U7YJR7_NICSY; probable WRKY transcription factor 20 isoform X1
TrEMBLA0A314L6192e-16A0A314L619_NICAT; Putative wrky transcription factor 20
STRINGMigut.H01775.1.p8e-55(Erythranthe guttata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.12e-17WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]
  2. Brand LH, et al.
    Screening for protein-DNA interactions by automatable DNA-protein interaction ELISA.
    PLoS ONE, 2013. 8(10): p. e75177
    [PMID:24146751]
  3. Ali MA,Wieczorek K,Kreil DP,Bohlmann H
    The beet cyst nematode Heterodera schachtii modulates the expression of WRKY transcription factors in syncytia to favour its development in Arabidopsis roots.
    PLoS ONE, 2014. 9(7): p. e102360
    [PMID:25033038]
  4. Divi UK,Rahman T,Krishna P
    Gene expression and functional analyses in brassinosteroid-mediated stress tolerance.
    Plant Biotechnol. J., 2016. 14(1): p. 419-32
    [PMID:25973891]
  5. Peskan-Berghöfer T, et al.
    Sustained exposure to abscisic acid enhances the colonization potential of the mutualist fungus Piriformospora indica on Arabidopsis thaliana roots.
    New Phytol., 2015. 208(3): p. 873-86
    [PMID:26075497]
  6. Wang C, et al.
    The Arabidopsis Mediator Complex Subunit16 Is a Key Component of Basal Resistance against the Necrotrophic Fungal Pathogen Sclerotinia sclerotiorum.
    Plant Physiol., 2015. 169(1): p. 856-72
    [PMID:26143252]
  7. Wang C, et al.
    Arabidopsis Elongator subunit 2 positively contributes to resistance to the necrotrophic fungal pathogens Botrytis cinerea and Alternaria brassicicola.
    Plant J., 2015. 83(6): p. 1019-33
    [PMID:26216741]
  8. Datta R, et al.
    Glutathione Regulates 1-Aminocyclopropane-1-Carboxylate Synthase Transcription via WRKY33 and 1-Aminocyclopropane-1-Carboxylate Oxidase by Modulating Messenger RNA Stability to Induce Ethylene Synthesis during Stress.
    Plant Physiol., 2015. 169(4): p. 2963-81
    [PMID:26463088]
  9. Daumann M,Fischer M,Niopek-Witz S,Girke C,Möhlmann T
    Apoplastic Nucleoside Accumulation in Arabidopsis Leads to Reduced Photosynthetic Performance and Increased Susceptibility Against Botrytis cinerea.
    Front Plant Sci, 2015. 6: p. 1158
    [PMID:26779190]
  10. Liu S,Bartnikas LM,Volko SM,Ausubel FM,Tang D
    Mutation of the Glucosinolate Biosynthesis Enzyme Cytochrome P450 83A1 Monooxygenase Increases Camalexin Accumulation and Powdery Mildew Resistance.
    Front Plant Sci, 2016. 7: p. 227
    [PMID:26973671]
  11. Jiang Y,Yu D
    The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance.
    Plant Physiol., 2016. 171(4): p. 2771-82
    [PMID:27268959]
  12. Liao CJ,Lai Z,Lee S,Yun DJ,Mengiste T
    Arabidopsis HOOKLESS1 Regulates Responses to Pathogens and Abscisic Acid through Interaction with MED18 and Acetylation of WRKY33 and ABI5 Chromatin.
    Plant Cell, 2016. 28(7): p. 1662-81
    [PMID:27317674]
  13. Birkenbihl RP,Kracher B,Roccaro M,Somssich IE
    Induced Genome-Wide Binding of Three Arabidopsis WRKY Transcription Factors during Early MAMP-Triggered Immunity.
    Plant Cell, 2017. 29(1): p. 20-38
    [PMID:28011690]
  14. Nguyen CC, et al.
    Overexpression of oligouridylate binding protein 1b results in ABA hypersensitivity.
    Plant Signal Behav, 2017. 12(2): p. e1282591
    [PMID:28112571]
  15. Liu S,Ziegler J,Zeier J,Birkenbihl RP,Somssich IE
    Botrytis cinerea B05.10 promotes disease development in Arabidopsis by suppressing WRKY33-mediated host immunity.
    Plant Cell Environ., 2017. 40(10): p. 2189-2206
    [PMID:28708934]
  16. D'Ambrosio JM, et al.
    Phospholipase C2 Affects MAMP-Triggered Immunity by Modulating ROS Production.
    Plant Physiol., 2017. 175(2): p. 970-981
    [PMID:28827453]
  17. Liu F, et al.
    Interactions of WRKY15 and WRKY33 transcription factors and their roles in the resistance of oilseed rape to Sclerotinia infection.
    Plant Biotechnol. J., 2018. 16(4): p. 911-925
    [PMID:28929638]
  18. Crespo-Salvador Ó,Escamilla-Aguilar M,López-Cruz J,López-Rodas G,González-Bosch C
    Determination of histone epigenetic marks in Arabidopsis and tomato genes in the early response to Botrytis cinerea.
    Plant Cell Rep., 2018. 37(1): p. 153-166
    [PMID:29119291]