![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Migut.H02390.1.p | ||||||||
| Common Name | MIMGU_mgv1a020111mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 81aa MW: 9259.81 Da PI: 10.7967 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 79.3 | 2.7e-25 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
k+ien++nrqvtfskRr g++KKA+E+ vLCd++ +i++s++g+l +s
Migut.H02390.1.p 9 KKIENTTNRQVTFSKRRYGLIKKAYEIAVLCDIDLTLIMLSPSGRLSHFS 58
78********************************************9997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 3.8E-31 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 27.502 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.88E-27 | 2 | 77 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.6E-23 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 6.2E-23 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.6E-23 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.6E-23 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 81 aa Download sequence Send to blast |
MGRSKLPIKK IENTTNRQVT FSKRRYGLIK KAYEIAVLCD IDLTLIMLSP SGRLSHFSGR 60 KRVEDVIYRY INLSDRDRGG * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 1e-16 | 1 | 75 | 1 | 74 | MEF2 CHIMERA |
| 6byy_B | 1e-16 | 1 | 75 | 1 | 74 | MEF2 CHIMERA |
| 6byy_C | 1e-16 | 1 | 75 | 1 | 74 | MEF2 CHIMERA |
| 6byy_D | 1e-16 | 1 | 75 | 1 | 74 | MEF2 CHIMERA |
| 6bz1_A | 9e-17 | 1 | 75 | 1 | 74 | MEF2 CHIMERA |
| 6bz1_B | 9e-17 | 1 | 75 | 1 | 74 | MEF2 CHIMERA |
| 6bz1_C | 9e-17 | 1 | 75 | 1 | 74 | MEF2 CHIMERA |
| 6bz1_D | 9e-17 | 1 | 75 | 1 | 74 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Migut.H02390.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011097601.1 | 4e-50 | agamous-like MADS-box protein AGL66 | ||||
| Refseq | XP_012844938.1 | 2e-52 | PREDICTED: MADS-box transcription factor 18-like | ||||
| Swissprot | Q1PFC2 | 1e-35 | AGL66_ARATH; Agamous-like MADS-box protein AGL66 | ||||
| TrEMBL | A0A022QT10 | 6e-51 | A0A022QT10_ERYGU; Uncharacterized protein | ||||
| TrEMBL | A0A4D8YQK2 | 7e-49 | A0A4D8YQK2_SALSN; Uncharacterized protein | ||||
| TrEMBL | A0A4D9AL80 | 8e-49 | A0A4D9AL80_SALSN; Uncharacterized protein | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA6183 | 19 | 25 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G77980.1 | 5e-38 | AGAMOUS-like 66 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Migut.H02390.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




