| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | NF-YB | 130.7 | 5e-41 | 1 | 87 | 8 | 94 |
NF-YB 8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
+Pian++rim+ +lPa+aki++dake++qec+sefisf+t ea+ +c+re rkti+++d+l a+a+lGf +y+epl+++l+k+r +
Migut.K01117.1.p 1 MPIANIIRIMRSILPAHAKIADDAKEVIQECISEFISFITIEANGRCHREYRKTITPEDVLAAMASLGFTNYLEPLTIFLNKHRAQK 87
8**********************************************************************************9765 PP
|
| Publications
? help Back to Top |
- Yang C, et al.
VAL- and AtBMI1-mediated H2Aub initiate the switch from embryonic to postgerminative growth in Arabidopsis. Curr. Biol., 2013. 23(14): p. 1324-9 [PMID:23810531] - Guo F, et al.
Induced expression of AtLEC1 and AtLEC2 differentially promotes somatic embryogenesis in transgenic tobacco plants. PLoS ONE, 2013. 8(8): p. e71714 [PMID:23951228] - Jia H,McCarty DR,Suzuki M
Distinct roles of LAFL network genes in promoting the embryonic seedling fate in the absence of VAL repression. Plant Physiol., 2013. 163(3): p. 1293-305 [PMID:24043445] - Kim HU, et al.
Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues. FEBS Open Bio, 2013. 4: p. 25-32 [PMID:24363987] - Garcês HM,Koenig D,Townsley BT,Kim M,Sinha NR
Truncation of LEAFY COTYLEDON1 protein is required for asexual reproduction in Kalanchoë daigremontiana. Plant Physiol., 2014. 165(1): p. 196-206 [PMID:24664206] - Rikiishi K,Maekawa M
Seed maturation regulators are related to the control of seed dormancy in wheat (Triticum aestivum L.). PLoS ONE, 2014. 9(9): p. e107618 [PMID:25211528] - Yamamoto A, et al.
Cell-by-cell developmental transition from embryo to post-germination phase revealed by heterochronic gene expression and ER-body formation in Arabidopsis leafy cotyledon mutants. Plant Cell Physiol., 2014. 55(12): p. 2112-25 [PMID:25282558] - Shen Y,Devic M,Lepiniec L,Zhou DX
Chromodomain, Helicase and DNA-binding CHD1 protein, CHR5, are involved in establishing active chromatin state of seed maturation genes. Plant Biotechnol. J., 2015. 13(6): p. 811-20 [PMID:25581843] - Yoshii M,Yamamoto A,Kagaya Y,Takeda S,Hattori T
The Arabidopsis transcription factor NAI1 is required for enhancing the active histone mark but not for removing the repressive mark on PYK10, a seedling-specific gene upon embryonic-to-postgerminative developmental phase transition. Plant Signal Behav, 2015. 10(12): p. e1105418 [PMID:26479492] - Huang M,Hu Y,Liu X,Li Y,Hou X
Arabidopsis LEAFY COTYLEDON1 Mediates Postembryonic Development via Interacting with PHYTOCHROME-INTERACTING FACTOR4. Plant Cell, 2015. 27(11): p. 3099-111 [PMID:26566918] - Huang M,Hu Y,Liu X,Li Y,Hou X
Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development. Front Plant Sci, 2015. 6: p. 955 [PMID:26579186] - Schneider A, et al.
Potential targets of VIVIPAROUS1/ABI3-LIKE1 (VAL1) repression in developing Arabidopsis thaliana embryos. Plant J., 2016. 85(2): p. 305-19 [PMID:26678037] - Baud S, et al.
Deciphering the Molecular Mechanisms Underpinning the Transcriptional Control of Gene Expression by Master Transcriptional Regulators in Arabidopsis Seed. Plant Physiol., 2016. 171(2): p. 1099-112 [PMID:27208266] - Fatihi A, et al.
Deciphering and modifying LAFL transcriptional regulatory network in seed for improving yield and quality of storage compounds. Plant Sci., 2016. 250: p. 198-204 [PMID:27457996] - Zhao H, et al.
The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] - Han JD, et al.
Evolutionary Analysis of the LAFL Genes Involved in the Land Plant Seed Maturation Program. Front Plant Sci, 2017. 8: p. 439 [PMID:28421087] - Pelletier JM, et al.
LEC1 sequentially regulates the transcription of genes involved in diverse developmental processes during seed development. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(32): p. E6710-E6719 [PMID:28739919] - Horstman A, et al.
The BABY BOOM Transcription Factor Activates the LEC1-ABI3-FUS3-LEC2 Network to Induce Somatic Embryogenesis. Plant Physiol., 2017. 175(2): p. 848-857 [PMID:28830937] - Tao Z, et al.
Embryonic epigenetic reprogramming by a pioneer transcription factor in plants. Nature, 2017. 551(7678): p. 124-128 [PMID:29072296] - Hanano A,Almousally I,Shaban M,Murphy DJ
Arabidopsis plants exposed to dioxin result in a WRINKLED seed phenotype due to 20S proteasomal degradation of WRI1. J. Exp. Bot., 2018. 69(7): p. 1781-1794 [PMID:29394403] - Chen N,Veerappan V,Abdelmageed H,Kang M,Allen RD
HSI2/VAL1 Silences AGL15 to Regulate the Developmental Transition from Seed Maturation to Vegetative Growth in Arabidopsis. Plant Cell, 2018. 30(3): p. 600-619 [PMID:29475938] - Boulard C, et al.
LEC1 (NF-YB9) directly interacts with LEC2 to control gene expression in seed. Biochim Biophys Acta Gene Regul Mech, 2018. 1861(5): p. 443-450 [PMID:29580949]
|