![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Migut.L00797.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 79aa MW: 9125.51 Da PI: 6.5108 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 67 | 5.2e-21 | 18 | 78 | 1 | 62 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFs 62
lppGfrFhPtd+el+++y++ kv + +l +i+evd++k+ePw+Lp +k +e+ewyfFs
Migut.L00797.1.p 18 LPPGFRFHPTDDELITFYIASKVFNGTLCG-VHIAEVDLNKCEPWKLPDVAKMGEREWYFFS 78
79*************************777.56***************8888899******6 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 9.68E-24 | 13 | 78 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 24.08 | 18 | 78 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.7E-9 | 19 | 78 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 79 aa Download sequence Send to blast |
MKYRVSLKEK KEVNEQGLPP GFRFHPTDDE LITFYIASKV FNGTLCGVHI AEVDLNKCEP 60 WKLPDVAKMG EREWYFFS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 5e-19 | 8 | 78 | 5 | 75 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Migut.L00797.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012838379.1 | 6e-41 | PREDICTED: protein CUP-SHAPED COTYLEDON 3 | ||||
| Swissprot | Q9S851 | 2e-35 | NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3 | ||||
| TrEMBL | A0A022R0T4 | 2e-41 | A0A022R0T4_ERYGU; Uncharacterized protein (Fragment) | ||||
| STRING | Migut.L00797.1.p | 8e-53 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA18010 | 4 | 4 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G76420.1 | 7e-38 | NAC family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Migut.L00797.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




