![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Migut.M00679.1.p | ||||||||
| Common Name | MIMGU_mgv1a023556mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 105aa MW: 12129.8 Da PI: 7.5138 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 123.3 | 9.7e-39 | 1 | 88 | 8 | 95 |
NF-YB 8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
+Pi+n++rim++vlPa+a+i++dake +qecvsefisf+t+ea+ +c+r+ r+t++++d+l + +lGf+dy+epl+++l+k+r +g
Migut.M00679.1.p 1 MPISNITRIMRRVLPAHARITDDAKEAIQECVSEFISFITTEANRRCHRDYRNTVTPEDVLATTVSLGFDDYLEPLTLFLNKHRTQQG 88
8***********************************************************************************8765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00808 | 1.3E-20 | 1 | 61 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 8.9E-37 | 1 | 91 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.13E-29 | 1 | 92 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 5.5E-14 | 28 | 46 | No hit | No description |
| PRINTS | PR00615 | 5.5E-14 | 47 | 65 | No hit | No description |
| PRINTS | PR00615 | 5.5E-14 | 66 | 84 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 105 aa Download sequence Send to blast |
MPISNITRIM RRVLPAHARI TDDAKEAIQE CVSEFISFIT TEANRRCHRD YRNTVTPEDV 60 LATTVSLGFD DYLEPLTLFL NKHRTQQGPD RDSTIQLPQF VRRGI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 4e-40 | 1 | 84 | 13 | 96 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Migut.M00679.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012836455.1 | 6e-66 | PREDICTED: nuclear transcription factor Y subunit B-6-like | ||||
| Swissprot | Q84W66 | 5e-39 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | A0A022RDA7 | 7e-68 | A0A022RDA7_ERYGU; Uncharacterized protein | ||||
| STRING | Migut.M00679.1.p | 1e-72 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA6044 | 4 | 36 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47670.2 | 1e-41 | nuclear factor Y, subunit B6 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Migut.M00679.1.p |




