![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Migut.M01124.1.p | ||||||||
| Common Name | LOC105969135, MIMGU_mgv1a015969mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 140aa MW: 16187.8 Da PI: 6.0421 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 133.2 | 8.7e-42 | 60 | 135 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
Cqve+C ad++ ak yhrrhkvCe+h+ka+vvl+s+l+qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk++
Migut.M01124.1.p 60 CQVEDCLADMNAAKAYHRRHKVCEFHAKATVVLLSELRQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSS 135
**************************************************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PIRSF | PIRSF037575 | 2.1E-57 | 1 | 139 | IPR017238 | Squamosa promoter-binding protein |
| Gene3D | G3DSA:4.10.1100.10 | 3.7E-33 | 53 | 121 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 31.368 | 57 | 134 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 9.16E-37 | 59 | 137 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 1.5E-31 | 60 | 133 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 140 aa Download sequence Send to blast |
MEEDKEEGKK ITVVSELEEE GEEEEDDDED FEDDNKKKRA LTPCKRRASS VGGGSTQRSC 60 QVEDCLADMN AAKAYHRRHK VCEFHAKATV VLLSELRQRF CQQCSRFHEL SEFDEAKRSC 120 RRRLAGHNER RRKSSYDSQ* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 2e-38 | 53 | 133 | 4 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Migut.M01124.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HM011588 | 1e-144 | HM011588.1 Mimulus guttatus ecotype Point Reyes SQUAMOSA-promoter binding protein 1 (SBP1) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012849329.1 | 1e-96 | PREDICTED: squamosa promoter-binding protein 1 | ||||
| Swissprot | Q38741 | 4e-60 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
| TrEMBL | A0A022QNF6 | 3e-95 | A0A022QNF6_ERYGU; Squamosa promoter-binding-like protein | ||||
| STRING | Migut.M01124.1.p | 5e-96 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA749 | 24 | 105 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G53160.2 | 9e-43 | squamosa promoter binding protein-like 4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Migut.M01124.1.p |
| Entrez Gene | 105969135 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




