![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Migut.N01995.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 133aa MW: 14860.6 Da PI: 5.0038 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 145 | 1.7e-45 | 4 | 98 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
e++++lPianv+r+mkk+lP ak+s++ake +q+c+sefi fvt+easd+c++e+rkt+ngdd++wal++lGf++y e++ yl+++r +e+e+
Migut.N01995.1.p 4 EHEKMLPIANVGRMMKKILPPSAKVSREAKERMQQCASEFICFVTGEASDRCHKENRKTVNGDDICWALSSLGFDNYSEAMLRYLQNFRGFEREN 98
7899****************************************************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 9.2E-43 | 3 | 115 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.84E-34 | 7 | 112 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 6.2E-24 | 9 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.2E-15 | 36 | 54 | No hit | No description |
| PRINTS | PR00615 | 2.2E-15 | 55 | 73 | No hit | No description |
| PRINTS | PR00615 | 2.2E-15 | 74 | 92 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 133 aa Download sequence Send to blast |
MSDEHEKMLP IANVGRMMKK ILPPSAKVSR EAKERMQQCA SEFICFVTGE ASDRCHKENR 60 KTVNGDDICW ALSSLGFDNY SEAMLRYLQN FRGFERENAN QSNNCKANSG EVEKDEGSIC 120 GDISAPSFDF GY* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 7e-35 | 4 | 92 | 3 | 91 | Transcription factor HapC (Eurofung) |
| 4g92_B | 7e-35 | 4 | 92 | 3 | 91 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Migut.N01995.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012847412.1 | 8e-96 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
| Refseq | XP_012857060.1 | 9e-96 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | O82248 | 3e-45 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A022QM27 | 5e-76 | A0A022QM27_ERYGU; Uncharacterized protein (Fragment) | ||||
| STRING | Migut.N01995.1.p | 3e-95 | (Erythranthe guttata) | ||||
| STRING | Migut.O00508.1.p | 3e-95 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 1e-47 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Migut.N01995.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




