![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Migut.O00333.1.p | ||||||||
| Common Name | MIMGU_mgv11b020310mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 112aa MW: 12543.9 Da PI: 6.5082 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 53.8 | 4.6e-17 | 16 | 66 | 44 | 94 |
NF-YB 44 sfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
sfvt+ea+ c+r+ r t++++d+l a+a+lG++dy+epl+++l+k+r +
Migut.O00333.1.p 16 SFVTAEANGWCNRDYRSTVTPEDVLAAMASLGLDDYLEPLTLFLNKHRAEQ 66
9**********************************************9754 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 7.9E-16 | 16 | 73 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.82E-13 | 16 | 74 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 1.3E-5 | 26 | 44 | No hit | No description |
| PRINTS | PR00615 | 1.3E-5 | 45 | 63 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 112 aa Download sequence Send to blast |
MPPTFRSPHR TLSANSFVTA EANGWCNRDY RSTVTPEDVL AAMASLGLDD YLEPLTLFLN 60 KHRAEQNSEQ GSMNFLPQFV RQGGDADASI GFIDTQQPQR THTVHRSTKY W* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 1e-15 | 16 | 63 | 49 | 96 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Migut.O00333.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012839452.1 | 1e-52 | PREDICTED: nuclear transcription factor Y subunit B-9-like | ||||
| Swissprot | Q84W66 | 3e-14 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | A0A022RVM3 | 8e-79 | A0A022RVM3_ERYGU; Uncharacterized protein | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47670.2 | 6e-17 | nuclear factor Y, subunit B6 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Migut.O00333.1.p |




