PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000694-RA
Organism
Nelumbo nucifera
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family NF-YC
Protein Properties Length: 103aa    MW: 11313.9 Da    PI: 10.706
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000694-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC24.55.6e-0826922086
          NF-YC 20 elPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrt 86
                   ++ + ri   lkad+  +++ a +Pv l+   e+++ e+   +w+  ++nk++ +    i+ av + 
  NNU_000694-RA 26 QFLVGRIASFLKADKYTERVGAGVPVYLAAVLEYLVAEVLELAWNAVRDNKKTRIVPRHIQLAVRNX 92
                   67789************************************************99999999999875 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004144.3E-334103IPR002119Histone H2A
SuperFamilySSF471131.3E-33594IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.7E-40994IPR009072Histone-fold
PfamPF001251.1E-111090IPR007125Histone H2A/H2B/H3
PRINTSPR006201.8E-341537IPR002119Histone H2A
PRINTSPR006201.8E-344459IPR002119Histone H2A
PRINTSPR006201.8E-345972IPR002119Histone H2A
PRINTSPR006201.8E-347387IPR002119Histone H2A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000786Cellular Componentnucleosome
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MAGRGKSLGA EASKKAASRS SKVGLQFLVG RIASFLKADK YTERVGAGVP VYLAAVLEYL  60
VAEVLELAWN AVRDNKKTRI VPRHIQLAVR NXEEQERSKK IAD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6c0w_C2e-40194193Histone H2A
6c0w_G2e-40194193Histone H2A
6j50_c2e-40194496Histone H2A type 1-B/E
6j50_g2e-40194496Histone H2A type 1-B/E
6j51_c2e-40194496Histone H2A type 1-B/E
6j51_g2e-40194496Histone H2A type 1-B/E
6r8y_C2e-40194496Histone H2A type 1-B/E
6r8y_G2e-40194496Histone H2A type 1-B/E
6r8z_C2e-40194496Histone H2A type 1-B/E
6r8z_G2e-40194496Histone H2A type 1-B/E
6r90_C2e-40194496Histone H2A type 1-B/E
6r90_G2e-40194496Histone H2A type 1-B/E
6r91_C2e-40194496Histone H2A type 1-B/E
6r91_G2e-40194496Histone H2A type 1-B/E
6r92_C2e-40194496Histone H2A type 1-B/E
6r92_G2e-40194496Histone H2A type 1-B/E
6r93_C2e-40194496Histone H2A type 1-B/E
6r93_G2e-40194496Histone H2A type 1-B/E
6r94_C2e-40194496Histone H2A type 1-B/E
6r94_G2e-40194496Histone H2A type 1-B/E
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtCore component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
UniProtCore component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010241030.18e-51PREDICTED: protein H2A.7
SwissprotA2YVE59e-50H2A3_ORYSI; Probable histone H2A.3
SwissprotQ84NJ49e-50H2A3_ORYSJ; Probable histone H2A.3
TrEMBLA0A1U7YMG12e-49A0A1U7YMG1_NELNU; Histone H2A
STRINGXP_010241030.13e-50(Nelumbo nucifera)